summaryrefslogtreecommitdiff
diff options
context:
space:
mode:
authorDimitri Sokolyuk <demon@dim13.org>2019-07-06 18:56:43 +0200
committerDimitri Sokolyuk <demon@dim13.org>2019-07-06 18:56:43 +0200
commit32dd62da990484cf15db8eb7a14bd646bc0fda8a (patch)
tree61c0468f8cad58bf5161a6fc53d0fc85b55951fc
parent6312ad4bf7e48347539eb5b4c5075e447d8142f3 (diff)
switch to go.mod
-rw-r--r--Gopkg.lock43
-rw-r--r--Gopkg.toml34
-rw-r--r--go.mod8
-rw-r--r--go.sum8
-rw-r--r--vendor/golang.org/x/net/html/atom/gen.go709
-rw-r--r--vendor/golang.org/x/net/html/atom/table.go1444
-rw-r--r--vendor/golang.org/x/net/html/const.go12
-rw-r--r--vendor/golang.org/x/net/html/entity.go4154
-rw-r--r--vendor/golang.org/x/net/html/foreign.go6
-rw-r--r--vendor/golang.org/x/net/html/node.go33
-rw-r--r--vendor/golang.org/x/net/html/parse.go529
-rw-r--r--vendor/golang.org/x/text/encoding/charmap/maketables.go556
-rw-r--r--vendor/golang.org/x/text/encoding/encoding.go2
-rw-r--r--vendor/golang.org/x/text/encoding/htmlindex/gen.go173
-rw-r--r--vendor/golang.org/x/text/encoding/htmlindex/tables.go1
-rw-r--r--vendor/golang.org/x/text/encoding/internal/identifier/gen.go137
-rw-r--r--vendor/golang.org/x/text/encoding/internal/identifier/identifier.go2
-rw-r--r--vendor/golang.org/x/text/encoding/internal/identifier/mib.go96
-rw-r--r--vendor/golang.org/x/text/encoding/japanese/maketables.go161
-rw-r--r--vendor/golang.org/x/text/encoding/korean/maketables.go143
-rw-r--r--vendor/golang.org/x/text/encoding/simplifiedchinese/maketables.go161
-rw-r--r--vendor/golang.org/x/text/encoding/traditionalchinese/maketables.go140
-rw-r--r--vendor/golang.org/x/text/encoding/unicode/unicode.go2
-rw-r--r--vendor/golang.org/x/text/internal/gen/code.go369
-rw-r--r--vendor/golang.org/x/text/internal/gen/gen.go333
-rw-r--r--vendor/golang.org/x/text/internal/language/common.go (renamed from vendor/golang.org/x/text/language/common.go)12
-rw-r--r--vendor/golang.org/x/text/internal/language/compact.go29
-rw-r--r--vendor/golang.org/x/text/internal/language/compact/compact.go61
-rw-r--r--vendor/golang.org/x/text/internal/language/compact/language.go260
-rw-r--r--vendor/golang.org/x/text/internal/language/compact/parents.go120
-rw-r--r--vendor/golang.org/x/text/internal/language/compact/tables.go1015
-rw-r--r--vendor/golang.org/x/text/internal/language/compact/tags.go91
-rw-r--r--vendor/golang.org/x/text/internal/language/compose.go167
-rw-r--r--vendor/golang.org/x/text/internal/language/coverage.go28
-rw-r--r--vendor/golang.org/x/text/internal/language/language.go596
-rw-r--r--vendor/golang.org/x/text/internal/language/lookup.go (renamed from vendor/golang.org/x/text/language/lookup.go)120
-rw-r--r--vendor/golang.org/x/text/internal/language/match.go226
-rw-r--r--vendor/golang.org/x/text/internal/language/parse.go594
-rw-r--r--vendor/golang.org/x/text/internal/language/tables.go3431
-rw-r--r--vendor/golang.org/x/text/internal/language/tags.go48
-rw-r--r--vendor/golang.org/x/text/language/Makefile16
-rw-r--r--vendor/golang.org/x/text/language/coverage.go34
-rw-r--r--vendor/golang.org/x/text/language/gen.go1712
-rw-r--r--vendor/golang.org/x/text/language/gen_common.go20
-rw-r--r--vendor/golang.org/x/text/language/gen_index.go162
-rw-r--r--vendor/golang.org/x/text/language/index.go783
-rw-r--r--vendor/golang.org/x/text/language/language.go720
-rw-r--r--vendor/golang.org/x/text/language/match.go422
-rw-r--r--vendor/golang.org/x/text/language/parse.go735
-rw-r--r--vendor/golang.org/x/text/language/tables.go3442
-rw-r--r--vendor/golang.org/x/text/language/tags.go160
-rw-r--r--vendor/golang.org/x/text/transform/transform.go6
-rw-r--r--vendor/golang.org/x/text/unicode/cldr/base.go105
-rw-r--r--vendor/golang.org/x/text/unicode/cldr/cldr.go130
-rw-r--r--vendor/golang.org/x/text/unicode/cldr/collate.go359
-rw-r--r--vendor/golang.org/x/text/unicode/cldr/decode.go171
-rw-r--r--vendor/golang.org/x/text/unicode/cldr/makexml.go400
-rw-r--r--vendor/golang.org/x/text/unicode/cldr/resolve.go602
-rw-r--r--vendor/golang.org/x/text/unicode/cldr/slice.go144
-rw-r--r--vendor/golang.org/x/text/unicode/cldr/xml.go1494
-rw-r--r--vendor/modules.txt22
61 files changed, 10594 insertions, 17099 deletions
diff --git a/Gopkg.lock b/Gopkg.lock
deleted file mode 100644
index 302f952..0000000
--- a/Gopkg.lock
+++ /dev/null
@@ -1,43 +0,0 @@
-# This file is autogenerated, do not edit; changes may be undone by the next 'dep ensure'.
-
-
-[[projects]]
- branch = "master"
- name = "golang.org/x/net"
- packages = [
- "html",
- "html/atom",
- "html/charset"
- ]
- revision = "0ed95abb35c445290478a5348a7b38bb154135fd"
-
-[[projects]]
- branch = "master"
- name = "golang.org/x/text"
- packages = [
- "encoding",
- "encoding/charmap",
- "encoding/htmlindex",
- "encoding/internal",
- "encoding/internal/identifier",
- "encoding/japanese",
- "encoding/korean",
- "encoding/simplifiedchinese",
- "encoding/traditionalchinese",
- "encoding/unicode",
- "internal/gen",
- "internal/tag",
- "internal/utf8internal",
- "language",
- "runes",
- "transform",
- "unicode/cldr"
- ]
- revision = "e19ae1496984b1c655b8044a65c0300a3c878dd3"
-
-[solve-meta]
- analyzer-name = "dep"
- analyzer-version = 1
- inputs-digest = "290fb5e489119984dcbdb44f1ca3089d33f1a8d33e5afc2c67a2bd0d226f5d8a"
- solver-name = "gps-cdcl"
- solver-version = 1
diff --git a/Gopkg.toml b/Gopkg.toml
deleted file mode 100644
index 0983863..0000000
--- a/Gopkg.toml
+++ /dev/null
@@ -1,34 +0,0 @@
-# Gopkg.toml example
-#
-# Refer to https://github.com/golang/dep/blob/master/docs/Gopkg.toml.md
-# for detailed Gopkg.toml documentation.
-#
-# required = ["github.com/user/thing/cmd/thing"]
-# ignored = ["github.com/user/project/pkgX", "bitbucket.org/user/project/pkgA/pkgY"]
-#
-# [[constraint]]
-# name = "github.com/user/project"
-# version = "1.0.0"
-#
-# [[constraint]]
-# name = "github.com/user/project2"
-# branch = "dev"
-# source = "github.com/myfork/project2"
-#
-# [[override]]
-# name = "github.com/x/y"
-# version = "2.4.0"
-#
-# [prune]
-# non-go = false
-# go-tests = true
-# unused-packages = true
-
-
-[[constraint]]
- branch = "master"
- name = "golang.org/x/net"
-
-[prune]
- go-tests = true
- unused-packages = true
diff --git a/go.mod b/go.mod
new file mode 100644
index 0000000..194ee86
--- /dev/null
+++ b/go.mod
@@ -0,0 +1,8 @@
+module dim13.org/rss
+
+go 1.13
+
+require (
+ golang.org/x/net v0.0.0-20190628185345-da137c7871d7
+ golang.org/x/text v0.3.2 // indirect
+)
diff --git a/go.sum b/go.sum
new file mode 100644
index 0000000..f1badd3
--- /dev/null
+++ b/go.sum
@@ -0,0 +1,8 @@
+golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
+golang.org/x/net v0.0.0-20190628185345-da137c7871d7 h1:rTIdg5QFRR7XCaK4LCjBiPbx8j4DQRpdYMnGn/bJUEU=
+golang.org/x/net v0.0.0-20190628185345-da137c7871d7/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
+golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
+golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
+golang.org/x/text v0.3.2 h1:tW2bmiBqwgJj/UpqtC8EpXEZVYOwU0yG4iWbprSVAcs=
+golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk=
+golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
diff --git a/vendor/golang.org/x/net/html/atom/gen.go b/vendor/golang.org/x/net/html/atom/gen.go
deleted file mode 100644
index cc5dc5d..0000000
--- a/vendor/golang.org/x/net/html/atom/gen.go
+++ /dev/null
@@ -1,709 +0,0 @@
-// Copyright 2012 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-//go:generate go run gen.go
-//go:generate go run gen.go -test
-
-package main
-
-import (
- "bytes"
- "flag"
- "fmt"
- "go/format"
- "io/ioutil"
- "math/rand"
- "os"
- "sort"
- "strings"
-)
-
-// identifier converts s to a Go exported identifier.
-// It converts "div" to "Div" and "accept-charset" to "AcceptCharset".
-func identifier(s string) string {
- b := make([]byte, 0, len(s))
- cap := true
- for _, c := range s {
- if c == '-' {
- cap = true
- continue
- }
- if cap && 'a' <= c && c <= 'z' {
- c -= 'a' - 'A'
- }
- cap = false
- b = append(b, byte(c))
- }
- return string(b)
-}
-
-var test = flag.Bool("test", false, "generate table_test.go")
-
-func genFile(name string, buf *bytes.Buffer) {
- b, err := format.Source(buf.Bytes())
- if err != nil {
- fmt.Fprintln(os.Stderr, err)
- os.Exit(1)
- }
- if err := ioutil.WriteFile(name, b, 0644); err != nil {
- fmt.Fprintln(os.Stderr, err)
- os.Exit(1)
- }
-}
-
-func main() {
- flag.Parse()
-
- var all []string
- all = append(all, elements...)
- all = append(all, attributes...)
- all = append(all, eventHandlers...)
- all = append(all, extra...)
- sort.Strings(all)
-
- // uniq - lists have dups
- w := 0
- for _, s := range all {
- if w == 0 || all[w-1] != s {
- all[w] = s
- w++
- }
- }
- all = all[:w]
-
- if *test {
- var buf bytes.Buffer
- fmt.Fprintln(&buf, "// Code generated by go generate gen.go; DO NOT EDIT.\n")
- fmt.Fprintln(&buf, "//go:generate go run gen.go -test\n")
- fmt.Fprintln(&buf, "package atom\n")
- fmt.Fprintln(&buf, "var testAtomList = []string{")
- for _, s := range all {
- fmt.Fprintf(&buf, "\t%q,\n", s)
- }
- fmt.Fprintln(&buf, "}")
-
- genFile("table_test.go", &buf)
- return
- }
-
- // Find hash that minimizes table size.
- var best *table
- for i := 0; i < 1000000; i++ {
- if best != nil && 1<<(best.k-1) < len(all) {
- break
- }
- h := rand.Uint32()
- for k := uint(0); k <= 16; k++ {
- if best != nil && k >= best.k {
- break
- }
- var t table
- if t.init(h, k, all) {
- best = &t
- break
- }
- }
- }
- if best == nil {
- fmt.Fprintf(os.Stderr, "failed to construct string table\n")
- os.Exit(1)
- }
-
- // Lay out strings, using overlaps when possible.
- layout := append([]string{}, all...)
-
- // Remove strings that are substrings of other strings
- for changed := true; changed; {
- changed = false
- for i, s := range layout {
- if s == "" {
- continue
- }
- for j, t := range layout {
- if i != j && t != "" && strings.Contains(s, t) {
- changed = true
- layout[j] = ""
- }
- }
- }
- }
-
- // Join strings where one suffix matches another prefix.
- for {
- // Find best i, j, k such that layout[i][len-k:] == layout[j][:k],
- // maximizing overlap length k.
- besti := -1
- bestj := -1
- bestk := 0
- for i, s := range layout {
- if s == "" {
- continue
- }
- for j, t := range layout {
- if i == j {
- continue
- }
- for k := bestk + 1; k <= len(s) && k <= len(t); k++ {
- if s[len(s)-k:] == t[:k] {
- besti = i
- bestj = j
- bestk = k
- }
- }
- }
- }
- if bestk > 0 {
- layout[besti] += layout[bestj][bestk:]
- layout[bestj] = ""
- continue
- }
- break
- }
-
- text := strings.Join(layout, "")
-
- atom := map[string]uint32{}
- for _, s := range all {
- off := strings.Index(text, s)
- if off < 0 {
- panic("lost string " + s)
- }
- atom[s] = uint32(off<<8 | len(s))
- }
-
- var buf bytes.Buffer
- // Generate the Go code.
- fmt.Fprintln(&buf, "// Code generated by go generate gen.go; DO NOT EDIT.\n")
- fmt.Fprintln(&buf, "//go:generate go run gen.go\n")
- fmt.Fprintln(&buf, "package atom\n\nconst (")
-
- // compute max len
- maxLen := 0
- for _, s := range all {
- if maxLen < len(s) {
- maxLen = len(s)
- }
- fmt.Fprintf(&buf, "\t%s Atom = %#x\n", identifier(s), atom[s])
- }
- fmt.Fprintln(&buf, ")\n")
-
- fmt.Fprintf(&buf, "const hash0 = %#x\n\n", best.h0)
- fmt.Fprintf(&buf, "const maxAtomLen = %d\n\n", maxLen)
-
- fmt.Fprintf(&buf, "var table = [1<<%d]Atom{\n", best.k)
- for i, s := range best.tab {
- if s == "" {
- continue
- }
- fmt.Fprintf(&buf, "\t%#x: %#x, // %s\n", i, atom[s], s)
- }
- fmt.Fprintf(&buf, "}\n")
- datasize := (1 << best.k) * 4
-
- fmt.Fprintln(&buf, "const atomText =")
- textsize := len(text)
- for len(text) > 60 {
- fmt.Fprintf(&buf, "\t%q +\n", text[:60])
- text = text[60:]
- }
- fmt.Fprintf(&buf, "\t%q\n\n", text)
-
- genFile("table.go", &buf)
-
- fmt.Fprintf(os.Stdout, "%d atoms; %d string bytes + %d tables = %d total data\n", len(all), textsize, datasize, textsize+datasize)
-}
-
-type byLen []string
-
-func (x byLen) Less(i, j int) bool { return len(x[i]) > len(x[j]) }
-func (x byLen) Swap(i, j int) { x[i], x[j] = x[j], x[i] }
-func (x byLen) Len() int { return len(x) }
-
-// fnv computes the FNV hash with an arbitrary starting value h.
-func fnv(h uint32, s string) uint32 {
- for i := 0; i < len(s); i++ {
- h ^= uint32(s[i])
- h *= 16777619
- }
- return h
-}
-
-// A table represents an attempt at constructing the lookup table.
-// The lookup table uses cuckoo hashing, meaning that each string
-// can be found in one of two positions.
-type table struct {
- h0 uint32
- k uint
- mask uint32
- tab []string
-}
-
-// hash returns the two hashes for s.
-func (t *table) hash(s string) (h1, h2 uint32) {
- h := fnv(t.h0, s)
- h1 = h & t.mask
- h2 = (h >> 16) & t.mask
- return
-}
-
-// init initializes the table with the given parameters.
-// h0 is the initial hash value,
-// k is the number of bits of hash value to use, and
-// x is the list of strings to store in the table.
-// init returns false if the table cannot be constructed.
-func (t *table) init(h0 uint32, k uint, x []string) bool {
- t.h0 = h0
- t.k = k
- t.tab = make([]string, 1<<k)
- t.mask = 1<<k - 1
- for _, s := range x {
- if !t.insert(s) {
- return false
- }
- }
- return true
-}
-
-// insert inserts s in the table.
-func (t *table) insert(s string) bool {
- h1, h2 := t.hash(s)
- if t.tab[h1] == "" {
- t.tab[h1] = s
- return true
- }
- if t.tab[h2] == "" {
- t.tab[h2] = s
- return true
- }
- if t.push(h1, 0) {
- t.tab[h1] = s
- return true
- }
- if t.push(h2, 0) {
- t.tab[h2] = s
- return true
- }
- return false
-}
-
-// push attempts to push aside the entry in slot i.
-func (t *table) push(i uint32, depth int) bool {
- if depth > len(t.tab) {
- return false
- }
- s := t.tab[i]
- h1, h2 := t.hash(s)
- j := h1 + h2 - i
- if t.tab[j] != "" && !t.push(j, depth+1) {
- return false
- }
- t.tab[j] = s
- return true
-}
-
-// The lists of element names and attribute keys were taken from
-// https://html.spec.whatwg.org/multipage/indices.html#index
-// as of the "HTML Living Standard - Last Updated 18 September 2017" version.
-
-// "command", "keygen" and "menuitem" have been removed from the spec,
-// but are kept here for backwards compatibility.
-var elements = []string{
- "a",
- "abbr",
- "address",
- "area",
- "article",
- "aside",
- "audio",
- "b",
- "base",
- "bdi",
- "bdo",
- "blockquote",
- "body",
- "br",
- "button",
- "canvas",
- "caption",
- "cite",
- "code",
- "col",
- "colgroup",
- "command",
- "data",
- "datalist",
- "dd",
- "del",
- "details",
- "dfn",
- "dialog",
- "div",
- "dl",
- "dt",
- "em",
- "embed",
- "fieldset",
- "figcaption",
- "figure",
- "footer",
- "form",
- "h1",
- "h2",
- "h3",
- "h4",
- "h5",
- "h6",
- "head",
- "header",
- "hgroup",
- "hr",
- "html",
- "i",
- "iframe",
- "img",
- "input",
- "ins",
- "kbd",
- "keygen",
- "label",
- "legend",
- "li",
- "link",
- "main",
- "map",
- "mark",
- "menu",
- "menuitem",
- "meta",
- "meter",
- "nav",
- "noscript",
- "object",
- "ol",
- "optgroup",
- "option",
- "output",
- "p",
- "param",
- "picture",
- "pre",
- "progress",
- "q",
- "rp",
- "rt",
- "ruby",
- "s",
- "samp",
- "script",
- "section",
- "select",
- "slot",
- "small",
- "source",
- "span",
- "strong",
- "style",
- "sub",
- "summary",
- "sup",
- "table",
- "tbody",
- "td",
- "template",
- "textarea",
- "tfoot",
- "th",
- "thead",
- "time",
- "title",
- "tr",
- "track",
- "u",
- "ul",
- "var",
- "video",
- "wbr",
-}
-
-// https://html.spec.whatwg.org/multipage/indices.html#attributes-3
-//
-// "challenge", "command", "contextmenu", "dropzone", "icon", "keytype", "mediagroup",
-// "radiogroup", "spellcheck", "scoped", "seamless", "sortable" and "sorted" have been removed from the spec,
-// but are kept here for backwards compatibility.
-var attributes = []string{
- "abbr",
- "accept",
- "accept-charset",
- "accesskey",
- "action",
- "allowfullscreen",
- "allowpaymentrequest",
- "allowusermedia",
- "alt",
- "as",
- "async",
- "autocomplete",
- "autofocus",
- "autoplay",
- "challenge",
- "charset",
- "checked",
- "cite",
- "class",
- "color",
- "cols",
- "colspan",
- "command",
- "content",
- "contenteditable",
- "contextmenu",
- "controls",
- "coords",
- "crossorigin",
- "data",
- "datetime",
- "default",
- "defer",
- "dir",
- "dirname",
- "disabled",
- "download",
- "draggable",
- "dropzone",
- "enctype",
- "for",
- "form",
- "formaction",
- "formenctype",
- "formmethod",
- "formnovalidate",
- "formtarget",
- "headers",
- "height",
- "hidden",
- "high",
- "href",
- "hreflang",
- "http-equiv",
- "icon",
- "id",
- "inputmode",
- "integrity",
- "is",
- "ismap",
- "itemid",
- "itemprop",
- "itemref",
- "itemscope",
- "itemtype",
- "keytype",
- "kind",
- "label",
- "lang",
- "list",
- "loop",
- "low",
- "manifest",
- "max",
- "maxlength",
- "media",
- "mediagroup",
- "method",
- "min",
- "minlength",
- "multiple",
- "muted",
- "name",
- "nomodule",
- "nonce",
- "novalidate",
- "open",
- "optimum",
- "pattern",
- "ping",
- "placeholder",
- "playsinline",
- "poster",
- "preload",
- "radiogroup",
- "readonly",
- "referrerpolicy",
- "rel",
- "required",
- "reversed",
- "rows",
- "rowspan",
- "sandbox",
- "spellcheck",
- "scope",
- "scoped",
- "seamless",
- "selected",
- "shape",
- "size",
- "sizes",
- "sortable",
- "sorted",
- "slot",
- "span",
- "spellcheck",
- "src",
- "srcdoc",
- "srclang",
- "srcset",
- "start",
- "step",
- "style",
- "tabindex",
- "target",
- "title",
- "translate",
- "type",
- "typemustmatch",
- "updateviacache",
- "usemap",
- "value",
- "width",
- "workertype",
- "wrap",
-}
-
-// "onautocomplete", "onautocompleteerror", "onmousewheel",
-// "onshow" and "onsort" have been removed from the spec,
-// but are kept here for backwards compatibility.
-var eventHandlers = []string{
- "onabort",
- "onautocomplete",
- "onautocompleteerror",
- "onauxclick",
- "onafterprint",
- "onbeforeprint",
- "onbeforeunload",
- "onblur",
- "oncancel",
- "oncanplay",
- "oncanplaythrough",
- "onchange",
- "onclick",
- "onclose",
- "oncontextmenu",
- "oncopy",
- "oncuechange",
- "oncut",
- "ondblclick",
- "ondrag",
- "ondragend",
- "ondragenter",
- "ondragexit",
- "ondragleave",
- "ondragover",
- "ondragstart",
- "ondrop",
- "ondurationchange",
- "onemptied",
- "onended",
- "onerror",
- "onfocus",
- "onhashchange",
- "oninput",
- "oninvalid",
- "onkeydown",
- "onkeypress",
- "onkeyup",
- "onlanguagechange",
- "onload",
- "onloadeddata",
- "onloadedmetadata",
- "onloadend",
- "onloadstart",
- "onmessage",
- "onmessageerror",
- "onmousedown",
- "onmouseenter",
- "onmouseleave",
- "onmousemove",
- "onmouseout",
- "onmouseover",
- "onmouseup",
- "onmousewheel",
- "onwheel",
- "onoffline",
- "ononline",
- "onpagehide",
- "onpageshow",
- "onpaste",
- "onpause",
- "onplay",
- "onplaying",
- "onpopstate",
- "onprogress",
- "onratechange",
- "onreset",
- "onresize",
- "onrejectionhandled",
- "onscroll",
- "onsecuritypolicyviolation",
- "onseeked",
- "onseeking",
- "onselect",
- "onshow",
- "onsort",
- "onstalled",
- "onstorage",
- "onsubmit",
- "onsuspend",
- "ontimeupdate",
- "ontoggle",
- "onunhandledrejection",
- "onunload",
- "onvolumechange",
- "onwaiting",
-}
-
-// extra are ad-hoc values not covered by any of the lists above.
-var extra = []string{
- "align",
- "annotation",
- "annotation-xml",
- "applet",
- "basefont",
- "bgsound",
- "big",
- "blink",
- "center",
- "color",
- "desc",
- "face",
- "font",
- "foreignObject", // HTML is case-insensitive, but SVG-embedded-in-HTML is case-sensitive.
- "foreignobject",
- "frame",
- "frameset",
- "image",
- "isindex",
- "listing",
- "malignmark",
- "marquee",
- "math",
- "mglyph",
- "mi",
- "mn",
- "mo",
- "ms",
- "mtext",
- "nobr",
- "noembed",
- "noframes",
- "plaintext",
- "prompt",
- "public",
- "spacer",
- "strike",
- "svg",
- "system",
- "tt",
- "xmp",
-}
diff --git a/vendor/golang.org/x/net/html/atom/table.go b/vendor/golang.org/x/net/html/atom/table.go
index f74018e..2a93886 100644
--- a/vendor/golang.org/x/net/html/atom/table.go
+++ b/vendor/golang.org/x/net/html/atom/table.go
@@ -10,366 +10,369 @@ const (
Accept Atom = 0x1a06
AcceptCharset Atom = 0x1a0e
Accesskey Atom = 0x2c09
- Action Atom = 0x25a06
- Address Atom = 0x6ed07
- Align Atom = 0x6d405
- Allowfullscreen Atom = 0x1f00f
- Allowpaymentrequest Atom = 0x6913
- Allowusermedia Atom = 0x850e
- Alt Atom = 0xb003
- Annotation Atom = 0x1b90a
- AnnotationXml Atom = 0x1b90e
- Applet Atom = 0x30106
- Area Atom = 0x34a04
- Article Atom = 0x3f007
- As Atom = 0xb902
- Aside Atom = 0xc105
- Async Atom = 0xb905
- Audio Atom = 0xcf05
- Autocomplete Atom = 0x2600c
- Autofocus Atom = 0xeb09
- Autoplay Atom = 0x10608
+ Acronym Atom = 0xaa07
+ Action Atom = 0x27206
+ Address Atom = 0x6f307
+ Align Atom = 0xb105
+ Allowfullscreen Atom = 0x2080f
+ Allowpaymentrequest Atom = 0xc113
+ Allowusermedia Atom = 0xdd0e
+ Alt Atom = 0xf303
+ Annotation Atom = 0x1c90a
+ AnnotationXml Atom = 0x1c90e
+ Applet Atom = 0x31906
+ Area Atom = 0x35604
+ Article Atom = 0x3fc07
+ As Atom = 0x3c02
+ Aside Atom = 0x10705
+ Async Atom = 0xff05
+ Audio Atom = 0x11505
+ Autocomplete Atom = 0x2780c
+ Autofocus Atom = 0x12109
+ Autoplay Atom = 0x13c08
B Atom = 0x101
- Base Atom = 0x11504
- Basefont Atom = 0x11508
- Bdi Atom = 0x16103
- Bdo Atom = 0x13403
- Bgsound Atom = 0x14707
- Big Atom = 0x15903
- Blink Atom = 0x15c05
- Blockquote Atom = 0x1680a
+ Base Atom = 0x3b04
+ Basefont Atom = 0x3b08
+ Bdi Atom = 0xba03
+ Bdo Atom = 0x14b03
+ Bgsound Atom = 0x15e07
+ Big Atom = 0x17003
+ Blink Atom = 0x17305
+ Blockquote Atom = 0x1870a
Body Atom = 0x2804
Br Atom = 0x202
- Button Atom = 0x17206
- Canvas Atom = 0xbd06
- Caption Atom = 0x21907
- Center Atom = 0x20806
- Challenge Atom = 0x28309
+ Button Atom = 0x19106
+ Canvas Atom = 0x10306
+ Caption Atom = 0x23107
+ Center Atom = 0x22006
+ Challenge Atom = 0x29b09
Charset Atom = 0x2107
- Checked Atom = 0x46d07
- Cite Atom = 0x55804
- Class Atom = 0x5b905
- Code Atom = 0x19004
- Col Atom = 0x19703
- Colgroup Atom = 0x19708
- Color Atom = 0x1af05
- Cols Atom = 0x1b404
- Colspan Atom = 0x1b407
- Command Atom = 0x1c707
- Content Atom = 0x57f07
- Contenteditable Atom = 0x57f0f
- Contextmenu Atom = 0x3740b
- Controls Atom = 0x1ce08
- Coords Atom = 0x1da06
- Crossorigin Atom = 0x1e30b
- Data Atom = 0x49904
- Datalist Atom = 0x49908
- Datetime Atom = 0x2a008
- Dd Atom = 0x2bf02
- Default Atom = 0xc407
- Defer Atom = 0x19205
- Del Atom = 0x44603
- Desc Atom = 0x55504
- Details Atom = 0x4607
- Dfn Atom = 0x5f03
- Dialog Atom = 0x16206
- Dir Atom = 0xa303
- Dirname Atom = 0xa307
- Disabled Atom = 0x14d08
- Div Atom = 0x15403
- Dl Atom = 0x5e202
- Download Atom = 0x45708
- Draggable Atom = 0x18309
- Dropzone Atom = 0x3f908
- Dt Atom = 0x64702
- Em Atom = 0x4202
- Embed Atom = 0x4205
- Enctype Atom = 0x27507
- Face Atom = 0x20604
- Fieldset Atom = 0x20e08
- Figcaption Atom = 0x2160a
- Figure Atom = 0x23006
- Font Atom = 0x11904
- Footer Atom = 0xb306
- For Atom = 0x23c03
- ForeignObject Atom = 0x23c0d
- Foreignobject Atom = 0x2490d
- Form Atom = 0x25604
- Formaction Atom = 0x2560a
- Formenctype Atom = 0x2710b
- Formmethod Atom = 0x28c0a
- Formnovalidate Atom = 0x2960e
- Formtarget Atom = 0x2a80a
- Frame Atom = 0x5705
- Frameset Atom = 0x5708
- H1 Atom = 0x14502
- H2 Atom = 0x2c602
- H3 Atom = 0x2f502
- H4 Atom = 0x33902
- H5 Atom = 0x34302
- H6 Atom = 0x64902
- Head Atom = 0x32504
- Header Atom = 0x32506
- Headers Atom = 0x32507
- Height Atom = 0x12c06
- Hgroup Atom = 0x2b206
- Hidden Atom = 0x2bd06
- High Atom = 0x2c304
- Hr Atom = 0x14002
- Href Atom = 0x2c804
- Hreflang Atom = 0x2c808
- Html Atom = 0x13004
- HttpEquiv Atom = 0x2d00a
+ Checked Atom = 0x47907
+ Cite Atom = 0x19c04
+ Class Atom = 0x56405
+ Code Atom = 0x5c504
+ Col Atom = 0x1ab03
+ Colgroup Atom = 0x1ab08
+ Color Atom = 0x1bf05
+ Cols Atom = 0x1c404
+ Colspan Atom = 0x1c407
+ Command Atom = 0x1d707
+ Content Atom = 0x58b07
+ Contenteditable Atom = 0x58b0f
+ Contextmenu Atom = 0x3800b
+ Controls Atom = 0x1de08
+ Coords Atom = 0x1ea06
+ Crossorigin Atom = 0x1fb0b
+ Data Atom = 0x4a504
+ Datalist Atom = 0x4a508
+ Datetime Atom = 0x2b808
+ Dd Atom = 0x2d702
+ Default Atom = 0x10a07
+ Defer Atom = 0x5c705
+ Del Atom = 0x45203
+ Desc Atom = 0x56104
+ Details Atom = 0x7207
+ Dfn Atom = 0x8703
+ Dialog Atom = 0xbb06
+ Dir Atom = 0x9303
+ Dirname Atom = 0x9307
+ Disabled Atom = 0x16408
+ Div Atom = 0x16b03
+ Dl Atom = 0x5e602
+ Download Atom = 0x46308
+ Draggable Atom = 0x17a09
+ Dropzone Atom = 0x40508
+ Dt Atom = 0x64b02
+ Em Atom = 0x6e02
+ Embed Atom = 0x6e05
+ Enctype Atom = 0x28d07
+ Face Atom = 0x21e04
+ Fieldset Atom = 0x22608
+ Figcaption Atom = 0x22e0a
+ Figure Atom = 0x24806
+ Font Atom = 0x3f04
+ Footer Atom = 0xf606
+ For Atom = 0x25403
+ ForeignObject Atom = 0x2540d
+ Foreignobject Atom = 0x2610d
+ Form Atom = 0x26e04
+ Formaction Atom = 0x26e0a
+ Formenctype Atom = 0x2890b
+ Formmethod Atom = 0x2a40a
+ Formnovalidate Atom = 0x2ae0e
+ Formtarget Atom = 0x2c00a
+ Frame Atom = 0x8b05
+ Frameset Atom = 0x8b08
+ H1 Atom = 0x15c02
+ H2 Atom = 0x2de02
+ H3 Atom = 0x30d02
+ H4 Atom = 0x34502
+ H5 Atom = 0x34f02
+ H6 Atom = 0x64d02
+ Head Atom = 0x33104
+ Header Atom = 0x33106
+ Headers Atom = 0x33107
+ Height Atom = 0x5206
+ Hgroup Atom = 0x2ca06
+ Hidden Atom = 0x2d506
+ High Atom = 0x2db04
+ Hr Atom = 0x15702
+ Href Atom = 0x2e004
+ Hreflang Atom = 0x2e008
+ Html Atom = 0x5604
+ HttpEquiv Atom = 0x2e80a
I Atom = 0x601
- Icon Atom = 0x57e04
- Id Atom = 0xc302
- Iframe Atom = 0x2e406
- Image Atom = 0x2ea05
- Img Atom = 0x2ef03
- Input Atom = 0x43f05
- Inputmode Atom = 0x43f09
- Ins Atom = 0x1ec03
- Integrity Atom = 0x22709
- Is Atom = 0x14e02
- Isindex Atom = 0x2f707
- Ismap Atom = 0x2fe05
- Itemid Atom = 0x37f06
- Itemprop Atom = 0x55908
- Itemref Atom = 0x3c107
- Itemscope Atom = 0x66d09
- Itemtype Atom = 0x30708
- Kbd Atom = 0x16003
+ Icon Atom = 0x58a04
+ Id Atom = 0x10902
+ Iframe Atom = 0x2fc06
+ Image Atom = 0x30205
+ Img Atom = 0x30703
+ Input Atom = 0x44b05
+ Inputmode Atom = 0x44b09
+ Ins Atom = 0x20403
+ Integrity Atom = 0x23f09
+ Is Atom = 0x16502
+ Isindex Atom = 0x30f07
+ Ismap Atom = 0x31605
+ Itemid Atom = 0x38b06
+ Itemprop Atom = 0x19d08
+ Itemref Atom = 0x3cd07
+ Itemscope Atom = 0x67109
+ Itemtype Atom = 0x31f08
+ Kbd Atom = 0xb903
Keygen Atom = 0x3206
- Keytype Atom = 0x7e07
- Kind Atom = 0x18004
- Label Atom = 0xda05
- Lang Atom = 0x2cc04
- Legend Atom = 0x18a06
- Li Atom = 0x11102
- Link Atom = 0x15d04
- List Atom = 0x49d04
- Listing Atom = 0x49d07
- Loop Atom = 0xde04
- Low Atom = 0x6b03
+ Keytype Atom = 0xd607
+ Kind Atom = 0x17704
+ Label Atom = 0x5905
+ Lang Atom = 0x2e404
+ Legend Atom = 0x18106
+ Li Atom = 0xb202
+ Link Atom = 0x17404
+ List Atom = 0x4a904
+ Listing Atom = 0x4a907
+ Loop Atom = 0x5d04
+ Low Atom = 0xc303
Main Atom = 0x1004
- Malignmark Atom = 0x6d30a
- Manifest Atom = 0x30f08
- Map Atom = 0x30003
- Mark Atom = 0x6d904
- Marquee Atom = 0x31b07
- Math Atom = 0x32204
- Max Atom = 0x33103
- Maxlength Atom = 0x33109
- Media Atom = 0x8e05
- Mediagroup Atom = 0x8e0a
- Menu Atom = 0x37b04
- Menuitem Atom = 0x37b08
- Meta Atom = 0x4ac04
- Meter Atom = 0xa805
- Method Atom = 0x29006
- Mglyph Atom = 0x2f006
- Mi Atom = 0x33b02
- Min Atom = 0x33b03
- Minlength Atom = 0x33b09
- Mn Atom = 0x29902
- Mo Atom = 0x6302
- Ms Atom = 0x67002
- Mtext Atom = 0x34505
- Multiple Atom = 0x35308
- Muted Atom = 0x35b05
- Name Atom = 0xa604
+ Malignmark Atom = 0xb00a
+ Manifest Atom = 0x6d708
+ Map Atom = 0x31803
+ Mark Atom = 0xb604
+ Marquee Atom = 0x32707
+ Math Atom = 0x32e04
+ Max Atom = 0x33d03
+ Maxlength Atom = 0x33d09
+ Media Atom = 0xe605
+ Mediagroup Atom = 0xe60a
+ Menu Atom = 0x38704
+ Menuitem Atom = 0x38708
+ Meta Atom = 0x4b804
+ Meter Atom = 0x9805
+ Method Atom = 0x2a806
+ Mglyph Atom = 0x30806
+ Mi Atom = 0x34702
+ Min Atom = 0x34703
+ Minlength Atom = 0x34709
+ Mn Atom = 0x2b102
+ Mo Atom = 0xa402
+ Ms Atom = 0x67402
+ Mtext Atom = 0x35105
+ Multiple Atom = 0x35f08
+ Muted Atom = 0x36705
+ Name Atom = 0x9604
Nav Atom = 0x1303
Nobr Atom = 0x3704
- Noembed Atom = 0x4007
- Noframes Atom = 0x5508
- Nomodule Atom = 0x6108
- Nonce Atom = 0x56205
- Noscript Atom = 0x1fe08
- Novalidate Atom = 0x29a0a
- Object Atom = 0x25006
- Ol Atom = 0x10102
- Onabort Atom = 0x17607
- Onafterprint Atom = 0x21e0c
- Onautocomplete Atom = 0x25e0e
- Onautocompleteerror Atom = 0x25e13
- Onauxclick Atom = 0x61b0a
- Onbeforeprint Atom = 0x69a0d
- Onbeforeunload Atom = 0x6e10e
- Onblur Atom = 0x5c206
- Oncancel Atom = 0xd308
- Oncanplay Atom = 0x13609
- Oncanplaythrough Atom = 0x13610
- Onchange Atom = 0x40f08
- Onclick Atom = 0x2dd07
- Onclose Atom = 0x36007
- Oncontextmenu Atom = 0x3720d
- Oncopy Atom = 0x38506
- Oncuechange Atom = 0x38b0b
- Oncut Atom = 0x39605
- Ondblclick Atom = 0x39b0a
- Ondrag Atom = 0x3a506
- Ondragend Atom = 0x3a509
- Ondragenter Atom = 0x3ae0b
- Ondragexit Atom = 0x3b90a
- Ondragleave Atom = 0x3d30b
- Ondragover Atom = 0x3de0a
- Ondragstart Atom = 0x3e80b
- Ondrop Atom = 0x3f706
- Ondurationchange Atom = 0x40710
- Onemptied Atom = 0x3fe09
- Onended Atom = 0x41707
- Onerror Atom = 0x41e07
- Onfocus Atom = 0x42507
- Onhashchange Atom = 0x4310c
- Oninput Atom = 0x43d07
- Oninvalid Atom = 0x44909
- Onkeydown Atom = 0x45209
- Onkeypress Atom = 0x45f0a
- Onkeyup Atom = 0x47407
- Onlanguagechange Atom = 0x48110
- Onload Atom = 0x49106
- Onloadeddata Atom = 0x4910c
- Onloadedmetadata Atom = 0x4a410
- Onloadend Atom = 0x4ba09
- Onloadstart Atom = 0x4c30b
- Onmessage Atom = 0x4ce09
- Onmessageerror Atom = 0x4ce0e
- Onmousedown Atom = 0x4dc0b
- Onmouseenter Atom = 0x4e70c
- Onmouseleave Atom = 0x4f30c
- Onmousemove Atom = 0x4ff0b
- Onmouseout Atom = 0x50a0a
- Onmouseover Atom = 0x5170b
- Onmouseup Atom = 0x52209
- Onmousewheel Atom = 0x5300c
- Onoffline Atom = 0x53c09
- Ononline Atom = 0x54508
- Onpagehide Atom = 0x54d0a
- Onpageshow Atom = 0x5670a
- Onpaste Atom = 0x57307
- Onpause Atom = 0x58e07
- Onplay Atom = 0x59806
- Onplaying Atom = 0x59809
- Onpopstate Atom = 0x5a10a
- Onprogress Atom = 0x5ab0a
- Onratechange Atom = 0x5c80c
- Onrejectionhandled Atom = 0x5d412
- Onreset Atom = 0x5e607
- Onresize Atom = 0x5ed08
- Onscroll Atom = 0x5fc08
- Onsecuritypolicyviolation Atom = 0x60419
- Onseeked Atom = 0x62508
- Onseeking Atom = 0x62d09
- Onselect Atom = 0x63608
- Onshow Atom = 0x64006
- Onsort Atom = 0x64b06
- Onstalled Atom = 0x65509
- Onstorage Atom = 0x65e09
- Onsubmit Atom = 0x66708
- Onsuspend Atom = 0x67709
- Ontimeupdate Atom = 0x11a0c
- Ontoggle Atom = 0x68008
- Onunhandledrejection Atom = 0x68814
- Onunload Atom = 0x6a708
- Onvolumechange Atom = 0x6af0e
- Onwaiting Atom = 0x6bd09
- Onwheel Atom = 0x6c607
- Open Atom = 0x55f04
- Optgroup Atom = 0xe008
- Optimum Atom = 0x6cd07
- Option Atom = 0x6dd06
- Output Atom = 0x51106
+ Noembed Atom = 0x6c07
+ Noframes Atom = 0x8908
+ Nomodule Atom = 0xa208
+ Nonce Atom = 0x1a605
+ Noscript Atom = 0x21608
+ Novalidate Atom = 0x2b20a
+ Object Atom = 0x26806
+ Ol Atom = 0x13702
+ Onabort Atom = 0x19507
+ Onafterprint Atom = 0x2360c
+ Onautocomplete Atom = 0x2760e
+ Onautocompleteerror Atom = 0x27613
+ Onauxclick Atom = 0x61f0a
+ Onbeforeprint Atom = 0x69e0d
+ Onbeforeunload Atom = 0x6e70e
+ Onblur Atom = 0x56d06
+ Oncancel Atom = 0x11908
+ Oncanplay Atom = 0x14d09
+ Oncanplaythrough Atom = 0x14d10
+ Onchange Atom = 0x41b08
+ Onclick Atom = 0x2f507
+ Onclose Atom = 0x36c07
+ Oncontextmenu Atom = 0x37e0d
+ Oncopy Atom = 0x39106
+ Oncuechange Atom = 0x3970b
+ Oncut Atom = 0x3a205
+ Ondblclick Atom = 0x3a70a
+ Ondrag Atom = 0x3b106
+ Ondragend Atom = 0x3b109
+ Ondragenter Atom = 0x3ba0b
+ Ondragexit Atom = 0x3c50a
+ Ondragleave Atom = 0x3df0b
+ Ondragover Atom = 0x3ea0a
+ Ondragstart Atom = 0x3f40b
+ Ondrop Atom = 0x40306
+ Ondurationchange Atom = 0x41310
+ Onemptied Atom = 0x40a09
+ Onended Atom = 0x42307
+ Onerror Atom = 0x42a07
+ Onfocus Atom = 0x43107
+ Onhashchange Atom = 0x43d0c
+ Oninput Atom = 0x44907
+ Oninvalid Atom = 0x45509
+ Onkeydown Atom = 0x45e09
+ Onkeypress Atom = 0x46b0a
+ Onkeyup Atom = 0x48007
+ Onlanguagechange Atom = 0x48d10
+ Onload Atom = 0x49d06
+ Onloadeddata Atom = 0x49d0c
+ Onloadedmetadata Atom = 0x4b010
+ Onloadend Atom = 0x4c609
+ Onloadstart Atom = 0x4cf0b
+ Onmessage Atom = 0x4da09
+ Onmessageerror Atom = 0x4da0e
+ Onmousedown Atom = 0x4e80b
+ Onmouseenter Atom = 0x4f30c
+ Onmouseleave Atom = 0x4ff0c
+ Onmousemove Atom = 0x50b0b
+ Onmouseout Atom = 0x5160a
+ Onmouseover Atom = 0x5230b
+ Onmouseup Atom = 0x52e09
+ Onmousewheel Atom = 0x53c0c
+ Onoffline Atom = 0x54809
+ Ononline Atom = 0x55108
+ Onpagehide Atom = 0x5590a
+ Onpageshow Atom = 0x5730a
+ Onpaste Atom = 0x57f07
+ Onpause Atom = 0x59a07
+ Onplay Atom = 0x5a406
+ Onplaying Atom = 0x5a409
+ Onpopstate Atom = 0x5ad0a
+ Onprogress Atom = 0x5b70a
+ Onratechange Atom = 0x5cc0c
+ Onrejectionhandled Atom = 0x5d812
+ Onreset Atom = 0x5ea07
+ Onresize Atom = 0x5f108
+ Onscroll Atom = 0x60008
+ Onsecuritypolicyviolation Atom = 0x60819
+ Onseeked Atom = 0x62908
+ Onseeking Atom = 0x63109
+ Onselect Atom = 0x63a08
+ Onshow Atom = 0x64406
+ Onsort Atom = 0x64f06
+ Onstalled Atom = 0x65909
+ Onstorage Atom = 0x66209
+ Onsubmit Atom = 0x66b08
+ Onsuspend Atom = 0x67b09
+ Ontimeupdate Atom = 0x400c
+ Ontoggle Atom = 0x68408
+ Onunhandledrejection Atom = 0x68c14
+ Onunload Atom = 0x6ab08
+ Onvolumechange Atom = 0x6b30e
+ Onwaiting Atom = 0x6c109
+ Onwheel Atom = 0x6ca07
+ Open Atom = 0x1a304
+ Optgroup Atom = 0x5f08
+ Optimum Atom = 0x6d107
+ Option Atom = 0x6e306
+ Output Atom = 0x51d06
P Atom = 0xc01
Param Atom = 0xc05
- Pattern Atom = 0x4f07
- Picture Atom = 0x9707
- Ping Atom = 0xe704
- Placeholder Atom = 0xfb0b
- Plaintext Atom = 0x19e09
- Playsinline Atom = 0x10a0b
- Poster Atom = 0x2b706
- Pre Atom = 0x46403
- Preload Atom = 0x47a07
- Progress Atom = 0x5ad08
- Prompt Atom = 0x52a06
- Public Atom = 0x57a06
- Q Atom = 0x7701
+ Pattern Atom = 0x6607
+ Picture Atom = 0x7b07
+ Ping Atom = 0xef04
+ Placeholder Atom = 0x1310b
+ Plaintext Atom = 0x1b209
+ Playsinline Atom = 0x1400b
+ Poster Atom = 0x2cf06
+ Pre Atom = 0x47003
+ Preload Atom = 0x48607
+ Progress Atom = 0x5b908
+ Prompt Atom = 0x53606
+ Public Atom = 0x58606
+ Q Atom = 0xcf01
Radiogroup Atom = 0x30a
- Readonly Atom = 0x34b08
- Referrerpolicy Atom = 0x3c50e
- Rel Atom = 0x47b03
- Required Atom = 0x23408
- Reversed Atom = 0x9c08
- Rows Atom = 0x3a04
- Rowspan Atom = 0x3a07
- Rp Atom = 0x22402
- Rt Atom = 0x17b02
- Ruby Atom = 0xac04
+ Rb Atom = 0x3a02
+ Readonly Atom = 0x35708
+ Referrerpolicy Atom = 0x3d10e
+ Rel Atom = 0x48703
+ Required Atom = 0x24c08
+ Reversed Atom = 0x8008
+ Rows Atom = 0x9c04
+ Rowspan Atom = 0x9c07
+ Rp Atom = 0x23c02
+ Rt Atom = 0x19a02
+ Rtc Atom = 0x19a03
+ Ruby Atom = 0xfb04
S Atom = 0x2501
- Samp Atom = 0x4c04
- Sandbox Atom = 0xf307
- Scope Atom = 0x67105
- Scoped Atom = 0x67106
- Script Atom = 0x20006
- Seamless Atom = 0x36508
- Section Atom = 0x5bd07
- Select Atom = 0x63806
- Selected Atom = 0x63808
- Shape Atom = 0x1d505
- Size Atom = 0x5f104
- Sizes Atom = 0x5f105
- Slot Atom = 0x1df04
- Small Atom = 0x1ee05
- Sortable Atom = 0x64d08
- Sorted Atom = 0x32b06
- Source Atom = 0x36c06
- Spacer Atom = 0x42b06
- Span Atom = 0x3d04
- Spellcheck Atom = 0x4680a
- Src Atom = 0x5b403
- Srcdoc Atom = 0x5b406
- Srclang Atom = 0x5f507
- Srcset Atom = 0x6f306
- Start Atom = 0x3ee05
- Step Atom = 0x57704
- Strike Atom = 0x7a06
- Strong Atom = 0x31506
- Style Atom = 0x6f905
- Sub Atom = 0x66903
- Summary Atom = 0x6fe07
- Sup Atom = 0x70503
- Svg Atom = 0x70803
- System Atom = 0x70b06
- Tabindex Atom = 0x4b208
- Table Atom = 0x58905
- Target Atom = 0x2ac06
+ Samp Atom = 0x7804
+ Sandbox Atom = 0x12907
+ Scope Atom = 0x67505
+ Scoped Atom = 0x67506
+ Script Atom = 0x21806
+ Seamless Atom = 0x37108
+ Section Atom = 0x56807
+ Select Atom = 0x63c06
+ Selected Atom = 0x63c08
+ Shape Atom = 0x1e505
+ Size Atom = 0x5f504
+ Sizes Atom = 0x5f505
+ Slot Atom = 0x1ef04
+ Small Atom = 0x20605
+ Sortable Atom = 0x65108
+ Sorted Atom = 0x33706
+ Source Atom = 0x37806
+ Spacer Atom = 0x43706
+ Span Atom = 0x9f04
+ Spellcheck Atom = 0x4740a
+ Src Atom = 0x5c003
+ Srcdoc Atom = 0x5c006
+ Srclang Atom = 0x5f907
+ Srcset Atom = 0x6f906
+ Start Atom = 0x3fa05
+ Step Atom = 0x58304
+ Strike Atom = 0xd206
+ Strong Atom = 0x6dd06
+ Style Atom = 0x6ff05
+ Sub Atom = 0x66d03
+ Summary Atom = 0x70407
+ Sup Atom = 0x70b03
+ Svg Atom = 0x70e03
+ System Atom = 0x71106
+ Tabindex Atom = 0x4be08
+ Table Atom = 0x59505
+ Target Atom = 0x2c406
Tbody Atom = 0x2705
- Td Atom = 0x5e02
- Template Atom = 0x70e08
- Textarea Atom = 0x34608
- Tfoot Atom = 0xb205
- Th Atom = 0x13f02
- Thead Atom = 0x32405
- Time Atom = 0x11c04
- Title Atom = 0xca05
- Tr Atom = 0x7402
- Track Atom = 0x17c05
- Translate Atom = 0x1a609
- Tt Atom = 0x5102
- Type Atom = 0x8104
- Typemustmatch Atom = 0x2780d
+ Td Atom = 0x9202
+ Template Atom = 0x71408
+ Textarea Atom = 0x35208
+ Tfoot Atom = 0xf505
+ Th Atom = 0x15602
+ Thead Atom = 0x33005
+ Time Atom = 0x4204
+ Title Atom = 0x11005
+ Tr Atom = 0xcc02
+ Track Atom = 0x1ba05
+ Translate Atom = 0x1f209
+ Tt Atom = 0x6802
+ Type Atom = 0xd904
+ Typemustmatch Atom = 0x2900d
U Atom = 0xb01
- Ul Atom = 0x6602
- Updateviacache Atom = 0x1200e
- Usemap Atom = 0x59206
+ Ul Atom = 0xa702
+ Updateviacache Atom = 0x460e
+ Usemap Atom = 0x59e06
Value Atom = 0x1505
- Var Atom = 0x15603
- Video Atom = 0x2d905
- Wbr Atom = 0x57003
- Width Atom = 0x64505
- Workertype Atom = 0x7160a
- Wrap Atom = 0x72004
- Xmp Atom = 0xf903
+ Var Atom = 0x16d03
+ Video Atom = 0x2f105
+ Wbr Atom = 0x57c03
+ Width Atom = 0x64905
+ Workertype Atom = 0x71c0a
+ Wrap Atom = 0x72604
+ Xmp Atom = 0x12f03
)
const hash0 = 0x81cdf10e
@@ -377,401 +380,404 @@ const hash0 = 0x81cdf10e
const maxAtomLen = 25
var table = [1 << 9]Atom{
- 0x1: 0x8e0a, // mediagroup
- 0x2: 0x2cc04, // lang
+ 0x1: 0xe60a, // mediagroup
+ 0x2: 0x2e404, // lang
0x4: 0x2c09, // accesskey
- 0x5: 0x5708, // frameset
- 0x7: 0x63608, // onselect
- 0x8: 0x70b06, // system
- 0xa: 0x64505, // width
- 0xc: 0x2710b, // formenctype
- 0xd: 0x10102, // ol
- 0xe: 0x38b0b, // oncuechange
- 0x10: 0x13403, // bdo
- 0x11: 0xcf05, // audio
- 0x12: 0x18309, // draggable
- 0x14: 0x2d905, // video
- 0x15: 0x29902, // mn
- 0x16: 0x37b04, // menu
- 0x17: 0x2b706, // poster
- 0x19: 0xb306, // footer
- 0x1a: 0x29006, // method
- 0x1b: 0x2a008, // datetime
- 0x1c: 0x17607, // onabort
- 0x1d: 0x1200e, // updateviacache
- 0x1e: 0xb905, // async
- 0x1f: 0x49106, // onload
- 0x21: 0xd308, // oncancel
- 0x22: 0x62508, // onseeked
- 0x23: 0x2ea05, // image
- 0x24: 0x5d412, // onrejectionhandled
- 0x26: 0x15d04, // link
- 0x27: 0x51106, // output
- 0x28: 0x32504, // head
- 0x29: 0x4f30c, // onmouseleave
- 0x2a: 0x57307, // onpaste
- 0x2b: 0x59809, // onplaying
- 0x2c: 0x1b407, // colspan
- 0x2f: 0x1af05, // color
- 0x30: 0x5f104, // size
- 0x31: 0x2d00a, // http-equiv
+ 0x5: 0x8b08, // frameset
+ 0x7: 0x63a08, // onselect
+ 0x8: 0x71106, // system
+ 0xa: 0x64905, // width
+ 0xc: 0x2890b, // formenctype
+ 0xd: 0x13702, // ol
+ 0xe: 0x3970b, // oncuechange
+ 0x10: 0x14b03, // bdo
+ 0x11: 0x11505, // audio
+ 0x12: 0x17a09, // draggable
+ 0x14: 0x2f105, // video
+ 0x15: 0x2b102, // mn
+ 0x16: 0x38704, // menu
+ 0x17: 0x2cf06, // poster
+ 0x19: 0xf606, // footer
+ 0x1a: 0x2a806, // method
+ 0x1b: 0x2b808, // datetime
+ 0x1c: 0x19507, // onabort
+ 0x1d: 0x460e, // updateviacache
+ 0x1e: 0xff05, // async
+ 0x1f: 0x49d06, // onload
+ 0x21: 0x11908, // oncancel
+ 0x22: 0x62908, // onseeked
+ 0x23: 0x30205, // image
+ 0x24: 0x5d812, // onrejectionhandled
+ 0x26: 0x17404, // link
+ 0x27: 0x51d06, // output
+ 0x28: 0x33104, // head
+ 0x29: 0x4ff0c, // onmouseleave
+ 0x2a: 0x57f07, // onpaste
+ 0x2b: 0x5a409, // onplaying
+ 0x2c: 0x1c407, // colspan
+ 0x2f: 0x1bf05, // color
+ 0x30: 0x5f504, // size
+ 0x31: 0x2e80a, // http-equiv
0x33: 0x601, // i
- 0x34: 0x54d0a, // onpagehide
- 0x35: 0x68814, // onunhandledrejection
- 0x37: 0x41e07, // onerror
- 0x3a: 0x11508, // basefont
+ 0x34: 0x5590a, // onpagehide
+ 0x35: 0x68c14, // onunhandledrejection
+ 0x37: 0x42a07, // onerror
+ 0x3a: 0x3b08, // basefont
0x3f: 0x1303, // nav
- 0x40: 0x18004, // kind
- 0x41: 0x34b08, // readonly
- 0x42: 0x2f006, // mglyph
- 0x44: 0x11102, // li
- 0x46: 0x2bd06, // hidden
- 0x47: 0x70803, // svg
- 0x48: 0x57704, // step
- 0x49: 0x22709, // integrity
- 0x4a: 0x57a06, // public
- 0x4c: 0x19703, // col
- 0x4d: 0x1680a, // blockquote
- 0x4e: 0x34302, // h5
- 0x50: 0x5ad08, // progress
- 0x51: 0x5f105, // sizes
- 0x52: 0x33902, // h4
- 0x56: 0x32405, // thead
- 0x57: 0x7e07, // keytype
- 0x58: 0x5ab0a, // onprogress
- 0x59: 0x43f09, // inputmode
- 0x5a: 0x3a509, // ondragend
- 0x5d: 0x39605, // oncut
- 0x5e: 0x42b06, // spacer
- 0x5f: 0x19708, // colgroup
- 0x62: 0x14e02, // is
- 0x65: 0xb902, // as
- 0x66: 0x53c09, // onoffline
- 0x67: 0x32b06, // sorted
- 0x69: 0x48110, // onlanguagechange
- 0x6c: 0x4310c, // onhashchange
- 0x6d: 0xa604, // name
- 0x6e: 0xb205, // tfoot
- 0x6f: 0x55504, // desc
- 0x70: 0x33103, // max
- 0x72: 0x1da06, // coords
- 0x73: 0x2f502, // h3
- 0x74: 0x6e10e, // onbeforeunload
- 0x75: 0x3a04, // rows
- 0x76: 0x63806, // select
- 0x77: 0xa805, // meter
- 0x78: 0x37f06, // itemid
- 0x79: 0x5300c, // onmousewheel
- 0x7a: 0x5b406, // srcdoc
- 0x7d: 0x17c05, // track
- 0x7f: 0x30708, // itemtype
- 0x82: 0x6302, // mo
- 0x83: 0x40f08, // onchange
- 0x84: 0x32507, // headers
- 0x85: 0x5c80c, // onratechange
- 0x86: 0x60419, // onsecuritypolicyviolation
- 0x88: 0x49908, // datalist
- 0x89: 0x4dc0b, // onmousedown
- 0x8a: 0x1df04, // slot
- 0x8b: 0x4a410, // onloadedmetadata
+ 0x40: 0x17704, // kind
+ 0x41: 0x35708, // readonly
+ 0x42: 0x30806, // mglyph
+ 0x44: 0xb202, // li
+ 0x46: 0x2d506, // hidden
+ 0x47: 0x70e03, // svg
+ 0x48: 0x58304, // step
+ 0x49: 0x23f09, // integrity
+ 0x4a: 0x58606, // public
+ 0x4c: 0x1ab03, // col
+ 0x4d: 0x1870a, // blockquote
+ 0x4e: 0x34f02, // h5
+ 0x50: 0x5b908, // progress
+ 0x51: 0x5f505, // sizes
+ 0x52: 0x34502, // h4
+ 0x56: 0x33005, // thead
+ 0x57: 0xd607, // keytype
+ 0x58: 0x5b70a, // onprogress
+ 0x59: 0x44b09, // inputmode
+ 0x5a: 0x3b109, // ondragend
+ 0x5d: 0x3a205, // oncut
+ 0x5e: 0x43706, // spacer
+ 0x5f: 0x1ab08, // colgroup
+ 0x62: 0x16502, // is
+ 0x65: 0x3c02, // as
+ 0x66: 0x54809, // onoffline
+ 0x67: 0x33706, // sorted
+ 0x69: 0x48d10, // onlanguagechange
+ 0x6c: 0x43d0c, // onhashchange
+ 0x6d: 0x9604, // name
+ 0x6e: 0xf505, // tfoot
+ 0x6f: 0x56104, // desc
+ 0x70: 0x33d03, // max
+ 0x72: 0x1ea06, // coords
+ 0x73: 0x30d02, // h3
+ 0x74: 0x6e70e, // onbeforeunload
+ 0x75: 0x9c04, // rows
+ 0x76: 0x63c06, // select
+ 0x77: 0x9805, // meter
+ 0x78: 0x38b06, // itemid
+ 0x79: 0x53c0c, // onmousewheel
+ 0x7a: 0x5c006, // srcdoc
+ 0x7d: 0x1ba05, // track
+ 0x7f: 0x31f08, // itemtype
+ 0x82: 0xa402, // mo
+ 0x83: 0x41b08, // onchange
+ 0x84: 0x33107, // headers
+ 0x85: 0x5cc0c, // onratechange
+ 0x86: 0x60819, // onsecuritypolicyviolation
+ 0x88: 0x4a508, // datalist
+ 0x89: 0x4e80b, // onmousedown
+ 0x8a: 0x1ef04, // slot
+ 0x8b: 0x4b010, // onloadedmetadata
0x8c: 0x1a06, // accept
- 0x8d: 0x25006, // object
- 0x91: 0x6af0e, // onvolumechange
+ 0x8d: 0x26806, // object
+ 0x91: 0x6b30e, // onvolumechange
0x92: 0x2107, // charset
- 0x93: 0x25e13, // onautocompleteerror
- 0x94: 0x6913, // allowpaymentrequest
+ 0x93: 0x27613, // onautocompleteerror
+ 0x94: 0xc113, // allowpaymentrequest
0x95: 0x2804, // body
- 0x96: 0xc407, // default
- 0x97: 0x63808, // selected
- 0x98: 0x20604, // face
- 0x99: 0x1d505, // shape
- 0x9b: 0x68008, // ontoggle
- 0x9e: 0x64702, // dt
- 0x9f: 0x6d904, // mark
+ 0x96: 0x10a07, // default
+ 0x97: 0x63c08, // selected
+ 0x98: 0x21e04, // face
+ 0x99: 0x1e505, // shape
+ 0x9b: 0x68408, // ontoggle
+ 0x9e: 0x64b02, // dt
+ 0x9f: 0xb604, // mark
0xa1: 0xb01, // u
- 0xa4: 0x6a708, // onunload
- 0xa5: 0xde04, // loop
- 0xa6: 0x14d08, // disabled
- 0xaa: 0x41707, // onended
- 0xab: 0x6d30a, // malignmark
- 0xad: 0x67709, // onsuspend
- 0xae: 0x34505, // mtext
- 0xaf: 0x64b06, // onsort
- 0xb0: 0x55908, // itemprop
- 0xb3: 0x66d09, // itemscope
- 0xb4: 0x15c05, // blink
- 0xb6: 0x3a506, // ondrag
- 0xb7: 0x6602, // ul
- 0xb8: 0x25604, // form
- 0xb9: 0xf307, // sandbox
- 0xba: 0x5705, // frame
+ 0xa4: 0x6ab08, // onunload
+ 0xa5: 0x5d04, // loop
+ 0xa6: 0x16408, // disabled
+ 0xaa: 0x42307, // onended
+ 0xab: 0xb00a, // malignmark
+ 0xad: 0x67b09, // onsuspend
+ 0xae: 0x35105, // mtext
+ 0xaf: 0x64f06, // onsort
+ 0xb0: 0x19d08, // itemprop
+ 0xb3: 0x67109, // itemscope
+ 0xb4: 0x17305, // blink
+ 0xb6: 0x3b106, // ondrag
+ 0xb7: 0xa702, // ul
+ 0xb8: 0x26e04, // form
+ 0xb9: 0x12907, // sandbox
+ 0xba: 0x8b05, // frame
0xbb: 0x1505, // value
- 0xbc: 0x65e09, // onstorage
- 0xc0: 0x17b02, // rt
+ 0xbc: 0x66209, // onstorage
+ 0xbf: 0xaa07, // acronym
+ 0xc0: 0x19a02, // rt
0xc2: 0x202, // br
- 0xc3: 0x20e08, // fieldset
- 0xc4: 0x2780d, // typemustmatch
- 0xc5: 0x6108, // nomodule
- 0xc6: 0x4007, // noembed
- 0xc7: 0x69a0d, // onbeforeprint
- 0xc8: 0x17206, // button
- 0xc9: 0x2dd07, // onclick
- 0xca: 0x6fe07, // summary
- 0xcd: 0xac04, // ruby
- 0xce: 0x5b905, // class
- 0xcf: 0x3e80b, // ondragstart
- 0xd0: 0x21907, // caption
- 0xd4: 0x850e, // allowusermedia
- 0xd5: 0x4c30b, // onloadstart
- 0xd9: 0x15403, // div
- 0xda: 0x49d04, // list
- 0xdb: 0x32204, // math
- 0xdc: 0x43f05, // input
- 0xdf: 0x3de0a, // ondragover
- 0xe0: 0x2c602, // h2
- 0xe2: 0x19e09, // plaintext
- 0xe4: 0x4e70c, // onmouseenter
- 0xe7: 0x46d07, // checked
- 0xe8: 0x46403, // pre
- 0xea: 0x35308, // multiple
- 0xeb: 0x16103, // bdi
- 0xec: 0x33109, // maxlength
- 0xed: 0x7701, // q
- 0xee: 0x61b0a, // onauxclick
- 0xf0: 0x57003, // wbr
- 0xf2: 0x11504, // base
- 0xf3: 0x6dd06, // option
- 0xf5: 0x40710, // ondurationchange
- 0xf7: 0x5508, // noframes
- 0xf9: 0x3f908, // dropzone
- 0xfb: 0x67105, // scope
- 0xfc: 0x9c08, // reversed
- 0xfd: 0x3ae0b, // ondragenter
- 0xfe: 0x3ee05, // start
- 0xff: 0xf903, // xmp
- 0x100: 0x5f507, // srclang
- 0x101: 0x2ef03, // img
+ 0xc3: 0x22608, // fieldset
+ 0xc4: 0x2900d, // typemustmatch
+ 0xc5: 0xa208, // nomodule
+ 0xc6: 0x6c07, // noembed
+ 0xc7: 0x69e0d, // onbeforeprint
+ 0xc8: 0x19106, // button
+ 0xc9: 0x2f507, // onclick
+ 0xca: 0x70407, // summary
+ 0xcd: 0xfb04, // ruby
+ 0xce: 0x56405, // class
+ 0xcf: 0x3f40b, // ondragstart
+ 0xd0: 0x23107, // caption
+ 0xd4: 0xdd0e, // allowusermedia
+ 0xd5: 0x4cf0b, // onloadstart
+ 0xd9: 0x16b03, // div
+ 0xda: 0x4a904, // list
+ 0xdb: 0x32e04, // math
+ 0xdc: 0x44b05, // input
+ 0xdf: 0x3ea0a, // ondragover
+ 0xe0: 0x2de02, // h2
+ 0xe2: 0x1b209, // plaintext
+ 0xe4: 0x4f30c, // onmouseenter
+ 0xe7: 0x47907, // checked
+ 0xe8: 0x47003, // pre
+ 0xea: 0x35f08, // multiple
+ 0xeb: 0xba03, // bdi
+ 0xec: 0x33d09, // maxlength
+ 0xed: 0xcf01, // q
+ 0xee: 0x61f0a, // onauxclick
+ 0xf0: 0x57c03, // wbr
+ 0xf2: 0x3b04, // base
+ 0xf3: 0x6e306, // option
+ 0xf5: 0x41310, // ondurationchange
+ 0xf7: 0x8908, // noframes
+ 0xf9: 0x40508, // dropzone
+ 0xfb: 0x67505, // scope
+ 0xfc: 0x8008, // reversed
+ 0xfd: 0x3ba0b, // ondragenter
+ 0xfe: 0x3fa05, // start
+ 0xff: 0x12f03, // xmp
+ 0x100: 0x5f907, // srclang
+ 0x101: 0x30703, // img
0x104: 0x101, // b
- 0x105: 0x23c03, // for
- 0x106: 0xc105, // aside
- 0x107: 0x43d07, // oninput
- 0x108: 0x34a04, // area
- 0x109: 0x28c0a, // formmethod
- 0x10a: 0x72004, // wrap
- 0x10c: 0x22402, // rp
- 0x10d: 0x45f0a, // onkeypress
- 0x10e: 0x5102, // tt
- 0x110: 0x33b02, // mi
- 0x111: 0x35b05, // muted
- 0x112: 0xb003, // alt
- 0x113: 0x19004, // code
- 0x114: 0x4202, // em
- 0x115: 0x3b90a, // ondragexit
- 0x117: 0x3d04, // span
- 0x119: 0x30f08, // manifest
- 0x11a: 0x37b08, // menuitem
- 0x11b: 0x57f07, // content
- 0x11d: 0x6bd09, // onwaiting
- 0x11f: 0x4ba09, // onloadend
- 0x121: 0x3720d, // oncontextmenu
- 0x123: 0x5c206, // onblur
- 0x124: 0x3f007, // article
- 0x125: 0xa303, // dir
- 0x126: 0xe704, // ping
- 0x127: 0x23408, // required
- 0x128: 0x44909, // oninvalid
- 0x129: 0x6d405, // align
- 0x12b: 0x57e04, // icon
- 0x12c: 0x64902, // h6
- 0x12d: 0x1b404, // cols
- 0x12e: 0x2160a, // figcaption
- 0x12f: 0x45209, // onkeydown
- 0x130: 0x66708, // onsubmit
- 0x131: 0x13609, // oncanplay
- 0x132: 0x70503, // sup
+ 0x105: 0x25403, // for
+ 0x106: 0x10705, // aside
+ 0x107: 0x44907, // oninput
+ 0x108: 0x35604, // area
+ 0x109: 0x2a40a, // formmethod
+ 0x10a: 0x72604, // wrap
+ 0x10c: 0x23c02, // rp
+ 0x10d: 0x46b0a, // onkeypress
+ 0x10e: 0x6802, // tt
+ 0x110: 0x34702, // mi
+ 0x111: 0x36705, // muted
+ 0x112: 0xf303, // alt
+ 0x113: 0x5c504, // code
+ 0x114: 0x6e02, // em
+ 0x115: 0x3c50a, // ondragexit
+ 0x117: 0x9f04, // span
+ 0x119: 0x6d708, // manifest
+ 0x11a: 0x38708, // menuitem
+ 0x11b: 0x58b07, // content
+ 0x11d: 0x6c109, // onwaiting
+ 0x11f: 0x4c609, // onloadend
+ 0x121: 0x37e0d, // oncontextmenu
+ 0x123: 0x56d06, // onblur
+ 0x124: 0x3fc07, // article
+ 0x125: 0x9303, // dir
+ 0x126: 0xef04, // ping
+ 0x127: 0x24c08, // required
+ 0x128: 0x45509, // oninvalid
+ 0x129: 0xb105, // align
+ 0x12b: 0x58a04, // icon
+ 0x12c: 0x64d02, // h6
+ 0x12d: 0x1c404, // cols
+ 0x12e: 0x22e0a, // figcaption
+ 0x12f: 0x45e09, // onkeydown
+ 0x130: 0x66b08, // onsubmit
+ 0x131: 0x14d09, // oncanplay
+ 0x132: 0x70b03, // sup
0x133: 0xc01, // p
- 0x135: 0x3fe09, // onemptied
- 0x136: 0x38506, // oncopy
- 0x137: 0x55804, // cite
- 0x138: 0x39b0a, // ondblclick
- 0x13a: 0x4ff0b, // onmousemove
- 0x13c: 0x66903, // sub
- 0x13d: 0x47b03, // rel
- 0x13e: 0xe008, // optgroup
- 0x142: 0x3a07, // rowspan
- 0x143: 0x36c06, // source
- 0x144: 0x1fe08, // noscript
- 0x145: 0x55f04, // open
- 0x146: 0x1ec03, // ins
- 0x147: 0x23c0d, // foreignObject
- 0x148: 0x5a10a, // onpopstate
- 0x14a: 0x27507, // enctype
- 0x14b: 0x25e0e, // onautocomplete
- 0x14c: 0x34608, // textarea
- 0x14e: 0x2600c, // autocomplete
- 0x14f: 0x14002, // hr
- 0x150: 0x1ce08, // controls
- 0x151: 0xc302, // id
- 0x153: 0x21e0c, // onafterprint
- 0x155: 0x2490d, // foreignobject
- 0x156: 0x31b07, // marquee
- 0x157: 0x58e07, // onpause
- 0x158: 0x5e202, // dl
- 0x159: 0x12c06, // height
- 0x15a: 0x33b03, // min
- 0x15b: 0xa307, // dirname
- 0x15c: 0x1a609, // translate
- 0x15d: 0x13004, // html
- 0x15e: 0x33b09, // minlength
- 0x15f: 0x47a07, // preload
- 0x160: 0x70e08, // template
- 0x161: 0x3d30b, // ondragleave
- 0x164: 0x5b403, // src
- 0x165: 0x31506, // strong
- 0x167: 0x4c04, // samp
- 0x168: 0x6ed07, // address
- 0x169: 0x54508, // ononline
- 0x16b: 0xfb0b, // placeholder
- 0x16c: 0x2ac06, // target
- 0x16d: 0x1ee05, // small
- 0x16e: 0x6c607, // onwheel
- 0x16f: 0x1b90a, // annotation
- 0x170: 0x4680a, // spellcheck
- 0x171: 0x4607, // details
- 0x172: 0xbd06, // canvas
- 0x173: 0xeb09, // autofocus
+ 0x135: 0x40a09, // onemptied
+ 0x136: 0x39106, // oncopy
+ 0x137: 0x19c04, // cite
+ 0x138: 0x3a70a, // ondblclick
+ 0x13a: 0x50b0b, // onmousemove
+ 0x13c: 0x66d03, // sub
+ 0x13d: 0x48703, // rel
+ 0x13e: 0x5f08, // optgroup
+ 0x142: 0x9c07, // rowspan
+ 0x143: 0x37806, // source
+ 0x144: 0x21608, // noscript
+ 0x145: 0x1a304, // open
+ 0x146: 0x20403, // ins
+ 0x147: 0x2540d, // foreignObject
+ 0x148: 0x5ad0a, // onpopstate
+ 0x14a: 0x28d07, // enctype
+ 0x14b: 0x2760e, // onautocomplete
+ 0x14c: 0x35208, // textarea
+ 0x14e: 0x2780c, // autocomplete
+ 0x14f: 0x15702, // hr
+ 0x150: 0x1de08, // controls
+ 0x151: 0x10902, // id
+ 0x153: 0x2360c, // onafterprint
+ 0x155: 0x2610d, // foreignobject
+ 0x156: 0x32707, // marquee
+ 0x157: 0x59a07, // onpause
+ 0x158: 0x5e602, // dl
+ 0x159: 0x5206, // height
+ 0x15a: 0x34703, // min
+ 0x15b: 0x9307, // dirname
+ 0x15c: 0x1f209, // translate
+ 0x15d: 0x5604, // html
+ 0x15e: 0x34709, // minlength
+ 0x15f: 0x48607, // preload
+ 0x160: 0x71408, // template
+ 0x161: 0x3df0b, // ondragleave
+ 0x162: 0x3a02, // rb
+ 0x164: 0x5c003, // src
+ 0x165: 0x6dd06, // strong
+ 0x167: 0x7804, // samp
+ 0x168: 0x6f307, // address
+ 0x169: 0x55108, // ononline
+ 0x16b: 0x1310b, // placeholder
+ 0x16c: 0x2c406, // target
+ 0x16d: 0x20605, // small
+ 0x16e: 0x6ca07, // onwheel
+ 0x16f: 0x1c90a, // annotation
+ 0x170: 0x4740a, // spellcheck
+ 0x171: 0x7207, // details
+ 0x172: 0x10306, // canvas
+ 0x173: 0x12109, // autofocus
0x174: 0xc05, // param
- 0x176: 0x45708, // download
- 0x177: 0x44603, // del
- 0x178: 0x36007, // onclose
- 0x179: 0x16003, // kbd
- 0x17a: 0x30106, // applet
- 0x17b: 0x2c804, // href
- 0x17c: 0x5ed08, // onresize
- 0x17e: 0x4910c, // onloadeddata
- 0x180: 0x7402, // tr
- 0x181: 0x2a80a, // formtarget
- 0x182: 0xca05, // title
- 0x183: 0x6f905, // style
- 0x184: 0x7a06, // strike
- 0x185: 0x59206, // usemap
- 0x186: 0x2e406, // iframe
+ 0x176: 0x46308, // download
+ 0x177: 0x45203, // del
+ 0x178: 0x36c07, // onclose
+ 0x179: 0xb903, // kbd
+ 0x17a: 0x31906, // applet
+ 0x17b: 0x2e004, // href
+ 0x17c: 0x5f108, // onresize
+ 0x17e: 0x49d0c, // onloadeddata
+ 0x180: 0xcc02, // tr
+ 0x181: 0x2c00a, // formtarget
+ 0x182: 0x11005, // title
+ 0x183: 0x6ff05, // style
+ 0x184: 0xd206, // strike
+ 0x185: 0x59e06, // usemap
+ 0x186: 0x2fc06, // iframe
0x187: 0x1004, // main
- 0x189: 0x9707, // picture
- 0x18c: 0x2fe05, // ismap
- 0x18e: 0x49904, // data
- 0x18f: 0xda05, // label
- 0x191: 0x3c50e, // referrerpolicy
- 0x192: 0x13f02, // th
- 0x194: 0x52a06, // prompt
- 0x195: 0x5bd07, // section
- 0x197: 0x6cd07, // optimum
- 0x198: 0x2c304, // high
- 0x199: 0x14502, // h1
- 0x19a: 0x65509, // onstalled
- 0x19b: 0x15603, // var
- 0x19c: 0x11c04, // time
- 0x19e: 0x67002, // ms
- 0x19f: 0x32506, // header
- 0x1a0: 0x4ce09, // onmessage
- 0x1a1: 0x56205, // nonce
- 0x1a2: 0x2560a, // formaction
- 0x1a3: 0x20806, // center
+ 0x189: 0x7b07, // picture
+ 0x18c: 0x31605, // ismap
+ 0x18e: 0x4a504, // data
+ 0x18f: 0x5905, // label
+ 0x191: 0x3d10e, // referrerpolicy
+ 0x192: 0x15602, // th
+ 0x194: 0x53606, // prompt
+ 0x195: 0x56807, // section
+ 0x197: 0x6d107, // optimum
+ 0x198: 0x2db04, // high
+ 0x199: 0x15c02, // h1
+ 0x19a: 0x65909, // onstalled
+ 0x19b: 0x16d03, // var
+ 0x19c: 0x4204, // time
+ 0x19e: 0x67402, // ms
+ 0x19f: 0x33106, // header
+ 0x1a0: 0x4da09, // onmessage
+ 0x1a1: 0x1a605, // nonce
+ 0x1a2: 0x26e0a, // formaction
+ 0x1a3: 0x22006, // center
0x1a4: 0x3704, // nobr
- 0x1a5: 0x58905, // table
- 0x1a6: 0x49d07, // listing
- 0x1a7: 0x18a06, // legend
- 0x1a9: 0x28309, // challenge
- 0x1aa: 0x23006, // figure
- 0x1ab: 0x8e05, // media
- 0x1ae: 0x8104, // type
- 0x1af: 0x11904, // font
- 0x1b0: 0x4ce0e, // onmessageerror
- 0x1b1: 0x36508, // seamless
- 0x1b2: 0x5f03, // dfn
- 0x1b3: 0x19205, // defer
- 0x1b4: 0x6b03, // low
- 0x1b5: 0x62d09, // onseeking
- 0x1b6: 0x5170b, // onmouseover
- 0x1b7: 0x29a0a, // novalidate
- 0x1b8: 0x7160a, // workertype
- 0x1ba: 0x3c107, // itemref
+ 0x1a5: 0x59505, // table
+ 0x1a6: 0x4a907, // listing
+ 0x1a7: 0x18106, // legend
+ 0x1a9: 0x29b09, // challenge
+ 0x1aa: 0x24806, // figure
+ 0x1ab: 0xe605, // media
+ 0x1ae: 0xd904, // type
+ 0x1af: 0x3f04, // font
+ 0x1b0: 0x4da0e, // onmessageerror
+ 0x1b1: 0x37108, // seamless
+ 0x1b2: 0x8703, // dfn
+ 0x1b3: 0x5c705, // defer
+ 0x1b4: 0xc303, // low
+ 0x1b5: 0x19a03, // rtc
+ 0x1b6: 0x5230b, // onmouseover
+ 0x1b7: 0x2b20a, // novalidate
+ 0x1b8: 0x71c0a, // workertype
+ 0x1ba: 0x3cd07, // itemref
0x1bd: 0x1, // a
- 0x1be: 0x30003, // map
- 0x1bf: 0x11a0c, // ontimeupdate
- 0x1c0: 0x14707, // bgsound
+ 0x1be: 0x31803, // map
+ 0x1bf: 0x400c, // ontimeupdate
+ 0x1c0: 0x15e07, // bgsound
0x1c1: 0x3206, // keygen
0x1c2: 0x2705, // tbody
- 0x1c5: 0x64006, // onshow
+ 0x1c5: 0x64406, // onshow
0x1c7: 0x2501, // s
- 0x1c8: 0x4f07, // pattern
- 0x1cc: 0x13610, // oncanplaythrough
- 0x1ce: 0x2bf02, // dd
- 0x1cf: 0x6f306, // srcset
- 0x1d0: 0x15903, // big
- 0x1d2: 0x64d08, // sortable
- 0x1d3: 0x47407, // onkeyup
- 0x1d5: 0x59806, // onplay
- 0x1d7: 0x4ac04, // meta
- 0x1d8: 0x3f706, // ondrop
- 0x1da: 0x5fc08, // onscroll
- 0x1db: 0x1e30b, // crossorigin
- 0x1dc: 0x5670a, // onpageshow
+ 0x1c8: 0x6607, // pattern
+ 0x1cc: 0x14d10, // oncanplaythrough
+ 0x1ce: 0x2d702, // dd
+ 0x1cf: 0x6f906, // srcset
+ 0x1d0: 0x17003, // big
+ 0x1d2: 0x65108, // sortable
+ 0x1d3: 0x48007, // onkeyup
+ 0x1d5: 0x5a406, // onplay
+ 0x1d7: 0x4b804, // meta
+ 0x1d8: 0x40306, // ondrop
+ 0x1da: 0x60008, // onscroll
+ 0x1db: 0x1fb0b, // crossorigin
+ 0x1dc: 0x5730a, // onpageshow
0x1dd: 0x4, // abbr
- 0x1de: 0x5e02, // td
- 0x1df: 0x57f0f, // contenteditable
- 0x1e0: 0x25a06, // action
- 0x1e1: 0x10a0b, // playsinline
- 0x1e2: 0x42507, // onfocus
- 0x1e3: 0x2c808, // hreflang
- 0x1e5: 0x50a0a, // onmouseout
- 0x1e6: 0x5e607, // onreset
- 0x1e7: 0x10608, // autoplay
- 0x1ea: 0x67106, // scoped
+ 0x1de: 0x9202, // td
+ 0x1df: 0x58b0f, // contenteditable
+ 0x1e0: 0x27206, // action
+ 0x1e1: 0x1400b, // playsinline
+ 0x1e2: 0x43107, // onfocus
+ 0x1e3: 0x2e008, // hreflang
+ 0x1e5: 0x5160a, // onmouseout
+ 0x1e6: 0x5ea07, // onreset
+ 0x1e7: 0x13c08, // autoplay
+ 0x1e8: 0x63109, // onseeking
+ 0x1ea: 0x67506, // scoped
0x1ec: 0x30a, // radiogroup
- 0x1ee: 0x3740b, // contextmenu
- 0x1ef: 0x52209, // onmouseup
- 0x1f1: 0x2b206, // hgroup
- 0x1f2: 0x1f00f, // allowfullscreen
- 0x1f3: 0x4b208, // tabindex
- 0x1f6: 0x2f707, // isindex
+ 0x1ee: 0x3800b, // contextmenu
+ 0x1ef: 0x52e09, // onmouseup
+ 0x1f1: 0x2ca06, // hgroup
+ 0x1f2: 0x2080f, // allowfullscreen
+ 0x1f3: 0x4be08, // tabindex
+ 0x1f6: 0x30f07, // isindex
0x1f7: 0x1a0e, // accept-charset
- 0x1f8: 0x2960e, // formnovalidate
- 0x1fb: 0x1b90e, // annotation-xml
- 0x1fc: 0x4205, // embed
- 0x1fd: 0x20006, // script
- 0x1fe: 0x16206, // dialog
- 0x1ff: 0x1c707, // command
+ 0x1f8: 0x2ae0e, // formnovalidate
+ 0x1fb: 0x1c90e, // annotation-xml
+ 0x1fc: 0x6e05, // embed
+ 0x1fd: 0x21806, // script
+ 0x1fe: 0xbb06, // dialog
+ 0x1ff: 0x1d707, // command
}
-const atomText = "abbradiogrouparamainavalueaccept-charsetbodyaccesskeygenobro" +
- "wspanoembedetailsampatternoframesetdfnomoduleallowpaymentreq" +
- "uestrikeytypeallowusermediagroupictureversedirnameterubyaltf" +
- "ooterasyncanvasidefaultitleaudioncancelabelooptgroupingautof" +
- "ocusandboxmplaceholderautoplaysinlinebasefontimeupdateviacac" +
- "heightmlbdoncanplaythrough1bgsoundisabledivarbigblinkbdialog" +
- "blockquotebuttonabortrackindraggablegendcodefercolgrouplaint" +
- "extranslatecolorcolspannotation-xmlcommandcontrolshapecoords" +
- "lotcrossoriginsmallowfullscreenoscriptfacenterfieldsetfigcap" +
- "tionafterprintegrityfigurequiredforeignObjectforeignobjectfo" +
- "rmactionautocompleteerrorformenctypemustmatchallengeformmeth" +
- "odformnovalidatetimeformtargethgrouposterhiddenhigh2hreflang" +
- "http-equivideonclickiframeimageimglyph3isindexismappletitemt" +
- "ypemanifestrongmarqueematheadersortedmaxlength4minlength5mte" +
- "xtareadonlymultiplemutedoncloseamlessourceoncontextmenuitemi" +
- "doncopyoncuechangeoncutondblclickondragendondragenterondrage" +
- "xitemreferrerpolicyondragleaveondragoverondragstarticleondro" +
- "pzonemptiedondurationchangeonendedonerroronfocuspaceronhashc" +
- "hangeoninputmodeloninvalidonkeydownloadonkeypresspellchecked" +
- "onkeyupreloadonlanguagechangeonloadeddatalistingonloadedmeta" +
- "databindexonloadendonloadstartonmessageerroronmousedownonmou" +
- "seenteronmouseleaveonmousemoveonmouseoutputonmouseoveronmous" +
- "eupromptonmousewheelonofflineononlineonpagehidescitempropeno" +
- "nceonpageshowbronpastepublicontenteditableonpausemaponplayin" +
- "gonpopstateonprogressrcdoclassectionbluronratechangeonreject" +
- "ionhandledonresetonresizesrclangonscrollonsecuritypolicyviol" +
- "ationauxclickonseekedonseekingonselectedonshowidth6onsortabl" +
- "eonstalledonstorageonsubmitemscopedonsuspendontoggleonunhand" +
- "ledrejectionbeforeprintonunloadonvolumechangeonwaitingonwhee" +
- "loptimumalignmarkoptionbeforeunloaddressrcsetstylesummarysup" +
- "svgsystemplateworkertypewrap"
+const atomText = "abbradiogrouparamainavalueaccept-charsetbodyaccesskeygenobrb" +
+ "asefontimeupdateviacacheightmlabelooptgroupatternoembedetail" +
+ "sampictureversedfnoframesetdirnameterowspanomoduleacronymali" +
+ "gnmarkbdialogallowpaymentrequestrikeytypeallowusermediagroup" +
+ "ingaltfooterubyasyncanvasidefaultitleaudioncancelautofocusan" +
+ "dboxmplaceholderautoplaysinlinebdoncanplaythrough1bgsoundisa" +
+ "bledivarbigblinkindraggablegendblockquotebuttonabortcitempro" +
+ "penoncecolgrouplaintextrackcolorcolspannotation-xmlcommandco" +
+ "ntrolshapecoordslotranslatecrossoriginsmallowfullscreenoscri" +
+ "ptfacenterfieldsetfigcaptionafterprintegrityfigurequiredfore" +
+ "ignObjectforeignobjectformactionautocompleteerrorformenctype" +
+ "mustmatchallengeformmethodformnovalidatetimeformtargethgroup" +
+ "osterhiddenhigh2hreflanghttp-equivideonclickiframeimageimgly" +
+ "ph3isindexismappletitemtypemarqueematheadersortedmaxlength4m" +
+ "inlength5mtextareadonlymultiplemutedoncloseamlessourceoncont" +
+ "extmenuitemidoncopyoncuechangeoncutondblclickondragendondrag" +
+ "enterondragexitemreferrerpolicyondragleaveondragoverondragst" +
+ "articleondropzonemptiedondurationchangeonendedonerroronfocus" +
+ "paceronhashchangeoninputmodeloninvalidonkeydownloadonkeypres" +
+ "spellcheckedonkeyupreloadonlanguagechangeonloadeddatalisting" +
+ "onloadedmetadatabindexonloadendonloadstartonmessageerroronmo" +
+ "usedownonmouseenteronmouseleaveonmousemoveonmouseoutputonmou" +
+ "seoveronmouseupromptonmousewheelonofflineononlineonpagehides" +
+ "classectionbluronpageshowbronpastepublicontenteditableonpaus" +
+ "emaponplayingonpopstateonprogressrcdocodeferonratechangeonre" +
+ "jectionhandledonresetonresizesrclangonscrollonsecuritypolicy" +
+ "violationauxclickonseekedonseekingonselectedonshowidth6onsor" +
+ "tableonstalledonstorageonsubmitemscopedonsuspendontoggleonun" +
+ "handledrejectionbeforeprintonunloadonvolumechangeonwaitingon" +
+ "wheeloptimumanifestrongoptionbeforeunloaddressrcsetstylesumm" +
+ "arysupsvgsystemplateworkertypewrap"
diff --git a/vendor/golang.org/x/net/html/const.go b/vendor/golang.org/x/net/html/const.go
index b37e621..a3a918f 100644
--- a/vendor/golang.org/x/net/html/const.go
+++ b/vendor/golang.org/x/net/html/const.go
@@ -4,7 +4,7 @@
package html
-// Section 12.2.3.2 of the HTML5 specification says "The following elements
+// Section 12.2.4.2 of the HTML5 specification says "The following elements
// have varying levels of special parsing rules".
// https://html.spec.whatwg.org/multipage/syntax.html#the-stack-of-open-elements
var isSpecialElementMap = map[string]bool{
@@ -97,8 +97,16 @@ func isSpecialElement(element *Node) bool {
switch element.Namespace {
case "", "html":
return isSpecialElementMap[element.Data]
+ case "math":
+ switch element.Data {
+ case "mi", "mo", "mn", "ms", "mtext", "annotation-xml":
+ return true
+ }
case "svg":
- return element.Data == "foreignObject"
+ switch element.Data {
+ case "foreignObject", "desc", "title":
+ return true
+ }
}
return false
}
diff --git a/vendor/golang.org/x/net/html/entity.go b/vendor/golang.org/x/net/html/entity.go
index a50c04c..b628880 100644
--- a/vendor/golang.org/x/net/html/entity.go
+++ b/vendor/golang.org/x/net/html/entity.go
@@ -75,2083 +75,2083 @@ var entity = map[string]rune{
"Copf;": '\U00002102',
"Coproduct;": '\U00002210',
"CounterClockwiseContourIntegral;": '\U00002233',
- "Cross;": '\U00002A2F',
- "Cscr;": '\U0001D49E',
- "Cup;": '\U000022D3',
- "CupCap;": '\U0000224D',
- "DD;": '\U00002145',
- "DDotrahd;": '\U00002911',
- "DJcy;": '\U00000402',
- "DScy;": '\U00000405',
- "DZcy;": '\U0000040F',
- "Dagger;": '\U00002021',
- "Darr;": '\U000021A1',
- "Dashv;": '\U00002AE4',
- "Dcaron;": '\U0000010E',
- "Dcy;": '\U00000414',
- "Del;": '\U00002207',
- "Delta;": '\U00000394',
- "Dfr;": '\U0001D507',
- "DiacriticalAcute;": '\U000000B4',
- "DiacriticalDot;": '\U000002D9',
- "DiacriticalDoubleAcute;": '\U000002DD',
- "DiacriticalGrave;": '\U00000060',
- "DiacriticalTilde;": '\U000002DC',
- "Diamond;": '\U000022C4',
- "DifferentialD;": '\U00002146',
- "Dopf;": '\U0001D53B',
- "Dot;": '\U000000A8',
- "DotDot;": '\U000020DC',
- "DotEqual;": '\U00002250',
- "DoubleContourIntegral;": '\U0000222F',
- "DoubleDot;": '\U000000A8',
- "DoubleDownArrow;": '\U000021D3',
- "DoubleLeftArrow;": '\U000021D0',
- "DoubleLeftRightArrow;": '\U000021D4',
- "DoubleLeftTee;": '\U00002AE4',
- "DoubleLongLeftArrow;": '\U000027F8',
- "DoubleLongLeftRightArrow;": '\U000027FA',
- "DoubleLongRightArrow;": '\U000027F9',
- "DoubleRightArrow;": '\U000021D2',
- "DoubleRightTee;": '\U000022A8',
- "DoubleUpArrow;": '\U000021D1',
- "DoubleUpDownArrow;": '\U000021D5',
- "DoubleVerticalBar;": '\U00002225',
- "DownArrow;": '\U00002193',
- "DownArrowBar;": '\U00002913',
- "DownArrowUpArrow;": '\U000021F5',
- "DownBreve;": '\U00000311',
- "DownLeftRightVector;": '\U00002950',
- "DownLeftTeeVector;": '\U0000295E',
- "DownLeftVector;": '\U000021BD',
- "DownLeftVectorBar;": '\U00002956',
- "DownRightTeeVector;": '\U0000295F',
- "DownRightVector;": '\U000021C1',
- "DownRightVectorBar;": '\U00002957',
- "DownTee;": '\U000022A4',
- "DownTeeArrow;": '\U000021A7',
- "Downarrow;": '\U000021D3',
- "Dscr;": '\U0001D49F',
- "Dstrok;": '\U00000110',
- "ENG;": '\U0000014A',
- "ETH;": '\U000000D0',
- "Eacute;": '\U000000C9',
- "Ecaron;": '\U0000011A',
- "Ecirc;": '\U000000CA',
- "Ecy;": '\U0000042D',
- "Edot;": '\U00000116',
- "Efr;": '\U0001D508',
- "Egrave;": '\U000000C8',
- "Element;": '\U00002208',
- "Emacr;": '\U00000112',
- "EmptySmallSquare;": '\U000025FB',
- "EmptyVerySmallSquare;": '\U000025AB',
- "Eogon;": '\U00000118',
- "Eopf;": '\U0001D53C',
- "Epsilon;": '\U00000395',
- "Equal;": '\U00002A75',
- "EqualTilde;": '\U00002242',
- "Equilibrium;": '\U000021CC',
- "Escr;": '\U00002130',
- "Esim;": '\U00002A73',
- "Eta;": '\U00000397',
- "Euml;": '\U000000CB',
- "Exists;": '\U00002203',
- "ExponentialE;": '\U00002147',
- "Fcy;": '\U00000424',
- "Ffr;": '\U0001D509',
- "FilledSmallSquare;": '\U000025FC',
- "FilledVerySmallSquare;": '\U000025AA',
- "Fopf;": '\U0001D53D',
- "ForAll;": '\U00002200',
- "Fouriertrf;": '\U00002131',
- "Fscr;": '\U00002131',
- "GJcy;": '\U00000403',
- "GT;": '\U0000003E',
- "Gamma;": '\U00000393',
- "Gammad;": '\U000003DC',
- "Gbreve;": '\U0000011E',
- "Gcedil;": '\U00000122',
- "Gcirc;": '\U0000011C',
- "Gcy;": '\U00000413',
- "Gdot;": '\U00000120',
- "Gfr;": '\U0001D50A',
- "Gg;": '\U000022D9',
- "Gopf;": '\U0001D53E',
- "GreaterEqual;": '\U00002265',
- "GreaterEqualLess;": '\U000022DB',
- "GreaterFullEqual;": '\U00002267',
- "GreaterGreater;": '\U00002AA2',
- "GreaterLess;": '\U00002277',
- "GreaterSlantEqual;": '\U00002A7E',
- "GreaterTilde;": '\U00002273',
- "Gscr;": '\U0001D4A2',
- "Gt;": '\U0000226B',
- "HARDcy;": '\U0000042A',
- "Hacek;": '\U000002C7',
- "Hat;": '\U0000005E',
- "Hcirc;": '\U00000124',
- "Hfr;": '\U0000210C',
- "HilbertSpace;": '\U0000210B',
- "Hopf;": '\U0000210D',
- "HorizontalLine;": '\U00002500',
- "Hscr;": '\U0000210B',
- "Hstrok;": '\U00000126',
- "HumpDownHump;": '\U0000224E',
- "HumpEqual;": '\U0000224F',
- "IEcy;": '\U00000415',
- "IJlig;": '\U00000132',
- "IOcy;": '\U00000401',
- "Iacute;": '\U000000CD',
- "Icirc;": '\U000000CE',
- "Icy;": '\U00000418',
- "Idot;": '\U00000130',
- "Ifr;": '\U00002111',
- "Igrave;": '\U000000CC',
- "Im;": '\U00002111',
- "Imacr;": '\U0000012A',
- "ImaginaryI;": '\U00002148',
- "Implies;": '\U000021D2',
- "Int;": '\U0000222C',
- "Integral;": '\U0000222B',
- "Intersection;": '\U000022C2',
- "InvisibleComma;": '\U00002063',
- "InvisibleTimes;": '\U00002062',
- "Iogon;": '\U0000012E',
- "Iopf;": '\U0001D540',
- "Iota;": '\U00000399',
- "Iscr;": '\U00002110',
- "Itilde;": '\U00000128',
- "Iukcy;": '\U00000406',
- "Iuml;": '\U000000CF',
- "Jcirc;": '\U00000134',
- "Jcy;": '\U00000419',
- "Jfr;": '\U0001D50D',
- "Jopf;": '\U0001D541',
- "Jscr;": '\U0001D4A5',
- "Jsercy;": '\U00000408',
- "Jukcy;": '\U00000404',
- "KHcy;": '\U00000425',
- "KJcy;": '\U0000040C',
- "Kappa;": '\U0000039A',
- "Kcedil;": '\U00000136',
- "Kcy;": '\U0000041A',
- "Kfr;": '\U0001D50E',
- "Kopf;": '\U0001D542',
- "Kscr;": '\U0001D4A6',
- "LJcy;": '\U00000409',
- "LT;": '\U0000003C',
- "Lacute;": '\U00000139',
- "Lambda;": '\U0000039B',
- "Lang;": '\U000027EA',
- "Laplacetrf;": '\U00002112',
- "Larr;": '\U0000219E',
- "Lcaron;": '\U0000013D',
- "Lcedil;": '\U0000013B',
- "Lcy;": '\U0000041B',
- "LeftAngleBracket;": '\U000027E8',
- "LeftArrow;": '\U00002190',
- "LeftArrowBar;": '\U000021E4',
- "LeftArrowRightArrow;": '\U000021C6',
- "LeftCeiling;": '\U00002308',
- "LeftDoubleBracket;": '\U000027E6',
- "LeftDownTeeVector;": '\U00002961',
- "LeftDownVector;": '\U000021C3',
- "LeftDownVectorBar;": '\U00002959',
- "LeftFloor;": '\U0000230A',
- "LeftRightArrow;": '\U00002194',
- "LeftRightVector;": '\U0000294E',
- "LeftTee;": '\U000022A3',
- "LeftTeeArrow;": '\U000021A4',
- "LeftTeeVector;": '\U0000295A',
- "LeftTriangle;": '\U000022B2',
- "LeftTriangleBar;": '\U000029CF',
- "LeftTriangleEqual;": '\U000022B4',
- "LeftUpDownVector;": '\U00002951',
- "LeftUpTeeVector;": '\U00002960',
- "LeftUpVector;": '\U000021BF',
- "LeftUpVectorBar;": '\U00002958',
- "LeftVector;": '\U000021BC',
- "LeftVectorBar;": '\U00002952',
- "Leftarrow;": '\U000021D0',
- "Leftrightarrow;": '\U000021D4',
- "LessEqualGreater;": '\U000022DA',
- "LessFullEqual;": '\U00002266',
- "LessGreater;": '\U00002276',
- "LessLess;": '\U00002AA1',
- "LessSlantEqual;": '\U00002A7D',
- "LessTilde;": '\U00002272',
- "Lfr;": '\U0001D50F',
- "Ll;": '\U000022D8',
- "Lleftarrow;": '\U000021DA',
- "Lmidot;": '\U0000013F',
- "LongLeftArrow;": '\U000027F5',
- "LongLeftRightArrow;": '\U000027F7',
- "LongRightArrow;": '\U000027F6',
- "Longleftarrow;": '\U000027F8',
- "Longleftrightarrow;": '\U000027FA',
- "Longrightarrow;": '\U000027F9',
- "Lopf;": '\U0001D543',
- "LowerLeftArrow;": '\U00002199',
- "LowerRightArrow;": '\U00002198',
- "Lscr;": '\U00002112',
- "Lsh;": '\U000021B0',
- "Lstrok;": '\U00000141',
- "Lt;": '\U0000226A',
- "Map;": '\U00002905',
- "Mcy;": '\U0000041C',
- "MediumSpace;": '\U0000205F',
- "Mellintrf;": '\U00002133',
- "Mfr;": '\U0001D510',
- "MinusPlus;": '\U00002213',
- "Mopf;": '\U0001D544',
- "Mscr;": '\U00002133',
- "Mu;": '\U0000039C',
- "NJcy;": '\U0000040A',
- "Nacute;": '\U00000143',
- "Ncaron;": '\U00000147',
- "Ncedil;": '\U00000145',
- "Ncy;": '\U0000041D',
- "NegativeMediumSpace;": '\U0000200B',
- "NegativeThickSpace;": '\U0000200B',
- "NegativeThinSpace;": '\U0000200B',
- "NegativeVeryThinSpace;": '\U0000200B',
- "NestedGreaterGreater;": '\U0000226B',
- "NestedLessLess;": '\U0000226A',
- "NewLine;": '\U0000000A',
- "Nfr;": '\U0001D511',
- "NoBreak;": '\U00002060',
- "NonBreakingSpace;": '\U000000A0',
- "Nopf;": '\U00002115',
- "Not;": '\U00002AEC',
- "NotCongruent;": '\U00002262',
- "NotCupCap;": '\U0000226D',
- "NotDoubleVerticalBar;": '\U00002226',
- "NotElement;": '\U00002209',
- "NotEqual;": '\U00002260',
- "NotExists;": '\U00002204',
- "NotGreater;": '\U0000226F',
- "NotGreaterEqual;": '\U00002271',
- "NotGreaterLess;": '\U00002279',
- "NotGreaterTilde;": '\U00002275',
- "NotLeftTriangle;": '\U000022EA',
- "NotLeftTriangleEqual;": '\U000022EC',
- "NotLess;": '\U0000226E',
- "NotLessEqual;": '\U00002270',
- "NotLessGreater;": '\U00002278',
- "NotLessTilde;": '\U00002274',
- "NotPrecedes;": '\U00002280',
- "NotPrecedesSlantEqual;": '\U000022E0',
- "NotReverseElement;": '\U0000220C',
- "NotRightTriangle;": '\U000022EB',
- "NotRightTriangleEqual;": '\U000022ED',
- "NotSquareSubsetEqual;": '\U000022E2',
- "NotSquareSupersetEqual;": '\U000022E3',
- "NotSubsetEqual;": '\U00002288',
- "NotSucceeds;": '\U00002281',
- "NotSucceedsSlantEqual;": '\U000022E1',
- "NotSupersetEqual;": '\U00002289',
- "NotTilde;": '\U00002241',
- "NotTildeEqual;": '\U00002244',
- "NotTildeFullEqual;": '\U00002247',
- "NotTildeTilde;": '\U00002249',
- "NotVerticalBar;": '\U00002224',
- "Nscr;": '\U0001D4A9',
- "Ntilde;": '\U000000D1',
- "Nu;": '\U0000039D',
- "OElig;": '\U00000152',
- "Oacute;": '\U000000D3',
- "Ocirc;": '\U000000D4',
- "Ocy;": '\U0000041E',
- "Odblac;": '\U00000150',
- "Ofr;": '\U0001D512',
- "Ograve;": '\U000000D2',
- "Omacr;": '\U0000014C',
- "Omega;": '\U000003A9',
- "Omicron;": '\U0000039F',
- "Oopf;": '\U0001D546',
- "OpenCurlyDoubleQuote;": '\U0000201C',
- "OpenCurlyQuote;": '\U00002018',
- "Or;": '\U00002A54',
- "Oscr;": '\U0001D4AA',
- "Oslash;": '\U000000D8',
- "Otilde;": '\U000000D5',
- "Otimes;": '\U00002A37',
- "Ouml;": '\U000000D6',
- "OverBar;": '\U0000203E',
- "OverBrace;": '\U000023DE',
- "OverBracket;": '\U000023B4',
- "OverParenthesis;": '\U000023DC',
- "PartialD;": '\U00002202',
- "Pcy;": '\U0000041F',
- "Pfr;": '\U0001D513',
- "Phi;": '\U000003A6',
- "Pi;": '\U000003A0',
- "PlusMinus;": '\U000000B1',
- "Poincareplane;": '\U0000210C',
- "Popf;": '\U00002119',
- "Pr;": '\U00002ABB',
- "Precedes;": '\U0000227A',
- "PrecedesEqual;": '\U00002AAF',
- "PrecedesSlantEqual;": '\U0000227C',
- "PrecedesTilde;": '\U0000227E',
- "Prime;": '\U00002033',
- "Product;": '\U0000220F',
- "Proportion;": '\U00002237',
- "Proportional;": '\U0000221D',
- "Pscr;": '\U0001D4AB',
- "Psi;": '\U000003A8',
- "QUOT;": '\U00000022',
- "Qfr;": '\U0001D514',
- "Qopf;": '\U0000211A',
- "Qscr;": '\U0001D4AC',
- "RBarr;": '\U00002910',
- "REG;": '\U000000AE',
- "Racute;": '\U00000154',
- "Rang;": '\U000027EB',
- "Rarr;": '\U000021A0',
- "Rarrtl;": '\U00002916',
- "Rcaron;": '\U00000158',
- "Rcedil;": '\U00000156',
- "Rcy;": '\U00000420',
- "Re;": '\U0000211C',
- "ReverseElement;": '\U0000220B',
- "ReverseEquilibrium;": '\U000021CB',
- "ReverseUpEquilibrium;": '\U0000296F',
- "Rfr;": '\U0000211C',
- "Rho;": '\U000003A1',
- "RightAngleBracket;": '\U000027E9',
- "RightArrow;": '\U00002192',
- "RightArrowBar;": '\U000021E5',
- "RightArrowLeftArrow;": '\U000021C4',
- "RightCeiling;": '\U00002309',
- "RightDoubleBracket;": '\U000027E7',
- "RightDownTeeVector;": '\U0000295D',
- "RightDownVector;": '\U000021C2',
- "RightDownVectorBar;": '\U00002955',
- "RightFloor;": '\U0000230B',
- "RightTee;": '\U000022A2',
- "RightTeeArrow;": '\U000021A6',
- "RightTeeVector;": '\U0000295B',
- "RightTriangle;": '\U000022B3',
- "RightTriangleBar;": '\U000029D0',
- "RightTriangleEqual;": '\U000022B5',
- "RightUpDownVector;": '\U0000294F',
- "RightUpTeeVector;": '\U0000295C',
- "RightUpVector;": '\U000021BE',
- "RightUpVectorBar;": '\U00002954',
- "RightVector;": '\U000021C0',
- "RightVectorBar;": '\U00002953',
- "Rightarrow;": '\U000021D2',
- "Ropf;": '\U0000211D',
- "RoundImplies;": '\U00002970',
- "Rrightarrow;": '\U000021DB',
- "Rscr;": '\U0000211B',
- "Rsh;": '\U000021B1',
- "RuleDelayed;": '\U000029F4',
- "SHCHcy;": '\U00000429',
- "SHcy;": '\U00000428',
- "SOFTcy;": '\U0000042C',
- "Sacute;": '\U0000015A',
- "Sc;": '\U00002ABC',
- "Scaron;": '\U00000160',
- "Scedil;": '\U0000015E',
- "Scirc;": '\U0000015C',
- "Scy;": '\U00000421',
- "Sfr;": '\U0001D516',
- "ShortDownArrow;": '\U00002193',
- "ShortLeftArrow;": '\U00002190',
- "ShortRightArrow;": '\U00002192',
- "ShortUpArrow;": '\U00002191',
- "Sigma;": '\U000003A3',
- "SmallCircle;": '\U00002218',
- "Sopf;": '\U0001D54A',
- "Sqrt;": '\U0000221A',
- "Square;": '\U000025A1',
- "SquareIntersection;": '\U00002293',
- "SquareSubset;": '\U0000228F',
- "SquareSubsetEqual;": '\U00002291',
- "SquareSuperset;": '\U00002290',
- "SquareSupersetEqual;": '\U00002292',
- "SquareUnion;": '\U00002294',
- "Sscr;": '\U0001D4AE',
- "Star;": '\U000022C6',
- "Sub;": '\U000022D0',
- "Subset;": '\U000022D0',
- "SubsetEqual;": '\U00002286',
- "Succeeds;": '\U0000227B',
- "SucceedsEqual;": '\U00002AB0',
- "SucceedsSlantEqual;": '\U0000227D',
- "SucceedsTilde;": '\U0000227F',
- "SuchThat;": '\U0000220B',
- "Sum;": '\U00002211',
- "Sup;": '\U000022D1',
- "Superset;": '\U00002283',
- "SupersetEqual;": '\U00002287',
- "Supset;": '\U000022D1',
- "THORN;": '\U000000DE',
- "TRADE;": '\U00002122',
- "TSHcy;": '\U0000040B',
- "TScy;": '\U00000426',
- "Tab;": '\U00000009',
- "Tau;": '\U000003A4',
- "Tcaron;": '\U00000164',
- "Tcedil;": '\U00000162',
- "Tcy;": '\U00000422',
- "Tfr;": '\U0001D517',
- "Therefore;": '\U00002234',
- "Theta;": '\U00000398',
- "ThinSpace;": '\U00002009',
- "Tilde;": '\U0000223C',
- "TildeEqual;": '\U00002243',
- "TildeFullEqual;": '\U00002245',
- "TildeTilde;": '\U00002248',
- "Topf;": '\U0001D54B',
- "TripleDot;": '\U000020DB',
- "Tscr;": '\U0001D4AF',
- "Tstrok;": '\U00000166',
- "Uacute;": '\U000000DA',
- "Uarr;": '\U0000219F',
- "Uarrocir;": '\U00002949',
- "Ubrcy;": '\U0000040E',
- "Ubreve;": '\U0000016C',
- "Ucirc;": '\U000000DB',
- "Ucy;": '\U00000423',
- "Udblac;": '\U00000170',
- "Ufr;": '\U0001D518',
- "Ugrave;": '\U000000D9',
- "Umacr;": '\U0000016A',
- "UnderBar;": '\U0000005F',
- "UnderBrace;": '\U000023DF',
- "UnderBracket;": '\U000023B5',
- "UnderParenthesis;": '\U000023DD',
- "Union;": '\U000022C3',
- "UnionPlus;": '\U0000228E',
- "Uogon;": '\U00000172',
- "Uopf;": '\U0001D54C',
- "UpArrow;": '\U00002191',
- "UpArrowBar;": '\U00002912',
- "UpArrowDownArrow;": '\U000021C5',
- "UpDownArrow;": '\U00002195',
- "UpEquilibrium;": '\U0000296E',
- "UpTee;": '\U000022A5',
- "UpTeeArrow;": '\U000021A5',
- "Uparrow;": '\U000021D1',
- "Updownarrow;": '\U000021D5',
- "UpperLeftArrow;": '\U00002196',
- "UpperRightArrow;": '\U00002197',
- "Upsi;": '\U000003D2',
- "Upsilon;": '\U000003A5',
- "Uring;": '\U0000016E',
- "Uscr;": '\U0001D4B0',
- "Utilde;": '\U00000168',
- "Uuml;": '\U000000DC',
- "VDash;": '\U000022AB',
- "Vbar;": '\U00002AEB',
- "Vcy;": '\U00000412',
- "Vdash;": '\U000022A9',
- "Vdashl;": '\U00002AE6',
- "Vee;": '\U000022C1',
- "Verbar;": '\U00002016',
- "Vert;": '\U00002016',
- "VerticalBar;": '\U00002223',
- "VerticalLine;": '\U0000007C',
- "VerticalSeparator;": '\U00002758',
- "VerticalTilde;": '\U00002240',
- "VeryThinSpace;": '\U0000200A',
- "Vfr;": '\U0001D519',
- "Vopf;": '\U0001D54D',
- "Vscr;": '\U0001D4B1',
- "Vvdash;": '\U000022AA',
- "Wcirc;": '\U00000174',
- "Wedge;": '\U000022C0',
- "Wfr;": '\U0001D51A',
- "Wopf;": '\U0001D54E',
- "Wscr;": '\U0001D4B2',
- "Xfr;": '\U0001D51B',
- "Xi;": '\U0000039E',
- "Xopf;": '\U0001D54F',
- "Xscr;": '\U0001D4B3',
- "YAcy;": '\U0000042F',
- "YIcy;": '\U00000407',
- "YUcy;": '\U0000042E',
- "Yacute;": '\U000000DD',
- "Ycirc;": '\U00000176',
- "Ycy;": '\U0000042B',
- "Yfr;": '\U0001D51C',
- "Yopf;": '\U0001D550',
- "Yscr;": '\U0001D4B4',
- "Yuml;": '\U00000178',
- "ZHcy;": '\U00000416',
- "Zacute;": '\U00000179',
- "Zcaron;": '\U0000017D',
- "Zcy;": '\U00000417',
- "Zdot;": '\U0000017B',
- "ZeroWidthSpace;": '\U0000200B',
- "Zeta;": '\U00000396',
- "Zfr;": '\U00002128',
- "Zopf;": '\U00002124',
- "Zscr;": '\U0001D4B5',
- "aacute;": '\U000000E1',
- "abreve;": '\U00000103',
- "ac;": '\U0000223E',
- "acd;": '\U0000223F',
- "acirc;": '\U000000E2',
- "acute;": '\U000000B4',
- "acy;": '\U00000430',
- "aelig;": '\U000000E6',
- "af;": '\U00002061',
- "afr;": '\U0001D51E',
- "agrave;": '\U000000E0',
- "alefsym;": '\U00002135',
- "aleph;": '\U00002135',
- "alpha;": '\U000003B1',
- "amacr;": '\U00000101',
- "amalg;": '\U00002A3F',
- "amp;": '\U00000026',
- "and;": '\U00002227',
- "andand;": '\U00002A55',
- "andd;": '\U00002A5C',
- "andslope;": '\U00002A58',
- "andv;": '\U00002A5A',
- "ang;": '\U00002220',
- "ange;": '\U000029A4',
- "angle;": '\U00002220',
- "angmsd;": '\U00002221',
- "angmsdaa;": '\U000029A8',
- "angmsdab;": '\U000029A9',
- "angmsdac;": '\U000029AA',
- "angmsdad;": '\U000029AB',
- "angmsdae;": '\U000029AC',
- "angmsdaf;": '\U000029AD',
- "angmsdag;": '\U000029AE',
- "angmsdah;": '\U000029AF',
- "angrt;": '\U0000221F',
- "angrtvb;": '\U000022BE',
- "angrtvbd;": '\U0000299D',
- "angsph;": '\U00002222',
- "angst;": '\U000000C5',
- "angzarr;": '\U0000237C',
- "aogon;": '\U00000105',
- "aopf;": '\U0001D552',
- "ap;": '\U00002248',
- "apE;": '\U00002A70',
- "apacir;": '\U00002A6F',
- "ape;": '\U0000224A',
- "apid;": '\U0000224B',
- "apos;": '\U00000027',
- "approx;": '\U00002248',
- "approxeq;": '\U0000224A',
- "aring;": '\U000000E5',
- "ascr;": '\U0001D4B6',
- "ast;": '\U0000002A',
- "asymp;": '\U00002248',
- "asympeq;": '\U0000224D',
- "atilde;": '\U000000E3',
- "auml;": '\U000000E4',
- "awconint;": '\U00002233',
- "awint;": '\U00002A11',
- "bNot;": '\U00002AED',
- "backcong;": '\U0000224C',
- "backepsilon;": '\U000003F6',
- "backprime;": '\U00002035',
- "backsim;": '\U0000223D',
- "backsimeq;": '\U000022CD',
- "barvee;": '\U000022BD',
- "barwed;": '\U00002305',
- "barwedge;": '\U00002305',
- "bbrk;": '\U000023B5',
- "bbrktbrk;": '\U000023B6',
- "bcong;": '\U0000224C',
- "bcy;": '\U00000431',
- "bdquo;": '\U0000201E',
- "becaus;": '\U00002235',
- "because;": '\U00002235',
- "bemptyv;": '\U000029B0',
- "bepsi;": '\U000003F6',
- "bernou;": '\U0000212C',
- "beta;": '\U000003B2',
- "beth;": '\U00002136',
- "between;": '\U0000226C',
- "bfr;": '\U0001D51F',
- "bigcap;": '\U000022C2',
- "bigcirc;": '\U000025EF',
- "bigcup;": '\U000022C3',
- "bigodot;": '\U00002A00',
- "bigoplus;": '\U00002A01',
- "bigotimes;": '\U00002A02',
- "bigsqcup;": '\U00002A06',
- "bigstar;": '\U00002605',
- "bigtriangledown;": '\U000025BD',
- "bigtriangleup;": '\U000025B3',
- "biguplus;": '\U00002A04',
- "bigvee;": '\U000022C1',
- "bigwedge;": '\U000022C0',
- "bkarow;": '\U0000290D',
- "blacklozenge;": '\U000029EB',
- "blacksquare;": '\U000025AA',
- "blacktriangle;": '\U000025B4',
- "blacktriangledown;": '\U000025BE',
- "blacktriangleleft;": '\U000025C2',
- "blacktriangleright;": '\U000025B8',
- "blank;": '\U00002423',
- "blk12;": '\U00002592',
- "blk14;": '\U00002591',
- "blk34;": '\U00002593',
- "block;": '\U00002588',
- "bnot;": '\U00002310',
- "bopf;": '\U0001D553',
- "bot;": '\U000022A5',
- "bottom;": '\U000022A5',
- "bowtie;": '\U000022C8',
- "boxDL;": '\U00002557',
- "boxDR;": '\U00002554',
- "boxDl;": '\U00002556',
- "boxDr;": '\U00002553',
- "boxH;": '\U00002550',
- "boxHD;": '\U00002566',
- "boxHU;": '\U00002569',
- "boxHd;": '\U00002564',
- "boxHu;": '\U00002567',
- "boxUL;": '\U0000255D',
- "boxUR;": '\U0000255A',
- "boxUl;": '\U0000255C',
- "boxUr;": '\U00002559',
- "boxV;": '\U00002551',
- "boxVH;": '\U0000256C',
- "boxVL;": '\U00002563',
- "boxVR;": '\U00002560',
- "boxVh;": '\U0000256B',
- "boxVl;": '\U00002562',
- "boxVr;": '\U0000255F',
- "boxbox;": '\U000029C9',
- "boxdL;": '\U00002555',
- "boxdR;": '\U00002552',
- "boxdl;": '\U00002510',
- "boxdr;": '\U0000250C',
- "boxh;": '\U00002500',
- "boxhD;": '\U00002565',
- "boxhU;": '\U00002568',
- "boxhd;": '\U0000252C',
- "boxhu;": '\U00002534',
- "boxminus;": '\U0000229F',
- "boxplus;": '\U0000229E',
- "boxtimes;": '\U000022A0',
- "boxuL;": '\U0000255B',
- "boxuR;": '\U00002558',
- "boxul;": '\U00002518',
- "boxur;": '\U00002514',
- "boxv;": '\U00002502',
- "boxvH;": '\U0000256A',
- "boxvL;": '\U00002561',
- "boxvR;": '\U0000255E',
- "boxvh;": '\U0000253C',
- "boxvl;": '\U00002524',
- "boxvr;": '\U0000251C',
- "bprime;": '\U00002035',
- "breve;": '\U000002D8',
- "brvbar;": '\U000000A6',
- "bscr;": '\U0001D4B7',
- "bsemi;": '\U0000204F',
- "bsim;": '\U0000223D',
- "bsime;": '\U000022CD',
- "bsol;": '\U0000005C',
- "bsolb;": '\U000029C5',
- "bsolhsub;": '\U000027C8',
- "bull;": '\U00002022',
- "bullet;": '\U00002022',
- "bump;": '\U0000224E',
- "bumpE;": '\U00002AAE',
- "bumpe;": '\U0000224F',
- "bumpeq;": '\U0000224F',
- "cacute;": '\U00000107',
- "cap;": '\U00002229',
- "capand;": '\U00002A44',
- "capbrcup;": '\U00002A49',
- "capcap;": '\U00002A4B',
- "capcup;": '\U00002A47',
- "capdot;": '\U00002A40',
- "caret;": '\U00002041',
- "caron;": '\U000002C7',
- "ccaps;": '\U00002A4D',
- "ccaron;": '\U0000010D',
- "ccedil;": '\U000000E7',
- "ccirc;": '\U00000109',
- "ccups;": '\U00002A4C',
- "ccupssm;": '\U00002A50',
- "cdot;": '\U0000010B',
- "cedil;": '\U000000B8',
- "cemptyv;": '\U000029B2',
- "cent;": '\U000000A2',
- "centerdot;": '\U000000B7',
- "cfr;": '\U0001D520',
- "chcy;": '\U00000447',
- "check;": '\U00002713',
- "checkmark;": '\U00002713',
- "chi;": '\U000003C7',
- "cir;": '\U000025CB',
- "cirE;": '\U000029C3',
- "circ;": '\U000002C6',
- "circeq;": '\U00002257',
- "circlearrowleft;": '\U000021BA',
- "circlearrowright;": '\U000021BB',
- "circledR;": '\U000000AE',
- "circledS;": '\U000024C8',
- "circledast;": '\U0000229B',
- "circledcirc;": '\U0000229A',
- "circleddash;": '\U0000229D',
- "cire;": '\U00002257',
- "cirfnint;": '\U00002A10',
- "cirmid;": '\U00002AEF',
- "cirscir;": '\U000029C2',
- "clubs;": '\U00002663',
- "clubsuit;": '\U00002663',
- "colon;": '\U0000003A',
- "colone;": '\U00002254',
- "coloneq;": '\U00002254',
- "comma;": '\U0000002C',
- "commat;": '\U00000040',
- "comp;": '\U00002201',
- "compfn;": '\U00002218',
- "complement;": '\U00002201',
- "complexes;": '\U00002102',
- "cong;": '\U00002245',
- "congdot;": '\U00002A6D',
- "conint;": '\U0000222E',
- "copf;": '\U0001D554',
- "coprod;": '\U00002210',
- "copy;": '\U000000A9',
- "copysr;": '\U00002117',
- "crarr;": '\U000021B5',
- "cross;": '\U00002717',
- "cscr;": '\U0001D4B8',
- "csub;": '\U00002ACF',
- "csube;": '\U00002AD1',
- "csup;": '\U00002AD0',
- "csupe;": '\U00002AD2',
- "ctdot;": '\U000022EF',
- "cudarrl;": '\U00002938',
- "cudarrr;": '\U00002935',
- "cuepr;": '\U000022DE',
- "cuesc;": '\U000022DF',
- "cularr;": '\U000021B6',
- "cularrp;": '\U0000293D',
- "cup;": '\U0000222A',
- "cupbrcap;": '\U00002A48',
- "cupcap;": '\U00002A46',
- "cupcup;": '\U00002A4A',
- "cupdot;": '\U0000228D',
- "cupor;": '\U00002A45',
- "curarr;": '\U000021B7',
- "curarrm;": '\U0000293C',
- "curlyeqprec;": '\U000022DE',
- "curlyeqsucc;": '\U000022DF',
- "curlyvee;": '\U000022CE',
- "curlywedge;": '\U000022CF',
- "curren;": '\U000000A4',
- "curvearrowleft;": '\U000021B6',
- "curvearrowright;": '\U000021B7',
- "cuvee;": '\U000022CE',
- "cuwed;": '\U000022CF',
- "cwconint;": '\U00002232',
- "cwint;": '\U00002231',
- "cylcty;": '\U0000232D',
- "dArr;": '\U000021D3',
- "dHar;": '\U00002965',
- "dagger;": '\U00002020',
- "daleth;": '\U00002138',
- "darr;": '\U00002193',
- "dash;": '\U00002010',
- "dashv;": '\U000022A3',
- "dbkarow;": '\U0000290F',
- "dblac;": '\U000002DD',
- "dcaron;": '\U0000010F',
- "dcy;": '\U00000434',
- "dd;": '\U00002146',
- "ddagger;": '\U00002021',
- "ddarr;": '\U000021CA',
- "ddotseq;": '\U00002A77',
- "deg;": '\U000000B0',
- "delta;": '\U000003B4',
- "demptyv;": '\U000029B1',
- "dfisht;": '\U0000297F',
- "dfr;": '\U0001D521',
- "dharl;": '\U000021C3',
- "dharr;": '\U000021C2',
- "diam;": '\U000022C4',
- "diamond;": '\U000022C4',
- "diamondsuit;": '\U00002666',
- "diams;": '\U00002666',
- "die;": '\U000000A8',
- "digamma;": '\U000003DD',
- "disin;": '\U000022F2',
- "div;": '\U000000F7',
- "divide;": '\U000000F7',
- "divideontimes;": '\U000022C7',
- "divonx;": '\U000022C7',
- "djcy;": '\U00000452',
- "dlcorn;": '\U0000231E',
- "dlcrop;": '\U0000230D',
- "dollar;": '\U00000024',
- "dopf;": '\U0001D555',
- "dot;": '\U000002D9',
- "doteq;": '\U00002250',
- "doteqdot;": '\U00002251',
- "dotminus;": '\U00002238',
- "dotplus;": '\U00002214',
- "dotsquare;": '\U000022A1',
- "doublebarwedge;": '\U00002306',
- "downarrow;": '\U00002193',
- "downdownarrows;": '\U000021CA',
- "downharpoonleft;": '\U000021C3',
- "downharpoonright;": '\U000021C2',
- "drbkarow;": '\U00002910',
- "drcorn;": '\U0000231F',
- "drcrop;": '\U0000230C',
- "dscr;": '\U0001D4B9',
- "dscy;": '\U00000455',
- "dsol;": '\U000029F6',
- "dstrok;": '\U00000111',
- "dtdot;": '\U000022F1',
- "dtri;": '\U000025BF',
- "dtrif;": '\U000025BE',
- "duarr;": '\U000021F5',
- "duhar;": '\U0000296F',
- "dwangle;": '\U000029A6',
- "dzcy;": '\U0000045F',
- "dzigrarr;": '\U000027FF',
- "eDDot;": '\U00002A77',
- "eDot;": '\U00002251',
- "eacute;": '\U000000E9',
- "easter;": '\U00002A6E',
- "ecaron;": '\U0000011B',
- "ecir;": '\U00002256',
- "ecirc;": '\U000000EA',
- "ecolon;": '\U00002255',
- "ecy;": '\U0000044D',
- "edot;": '\U00000117',
- "ee;": '\U00002147',
- "efDot;": '\U00002252',
- "efr;": '\U0001D522',
- "eg;": '\U00002A9A',
- "egrave;": '\U000000E8',
- "egs;": '\U00002A96',
- "egsdot;": '\U00002A98',
- "el;": '\U00002A99',
- "elinters;": '\U000023E7',
- "ell;": '\U00002113',
- "els;": '\U00002A95',
- "elsdot;": '\U00002A97',
- "emacr;": '\U00000113',
- "empty;": '\U00002205',
- "emptyset;": '\U00002205',
- "emptyv;": '\U00002205',
- "emsp;": '\U00002003',
- "emsp13;": '\U00002004',
- "emsp14;": '\U00002005',
- "eng;": '\U0000014B',
- "ensp;": '\U00002002',
- "eogon;": '\U00000119',
- "eopf;": '\U0001D556',
- "epar;": '\U000022D5',
- "eparsl;": '\U000029E3',
- "eplus;": '\U00002A71',
- "epsi;": '\U000003B5',
- "epsilon;": '\U000003B5',
- "epsiv;": '\U000003F5',
- "eqcirc;": '\U00002256',
- "eqcolon;": '\U00002255',
- "eqsim;": '\U00002242',
- "eqslantgtr;": '\U00002A96',
- "eqslantless;": '\U00002A95',
- "equals;": '\U0000003D',
- "equest;": '\U0000225F',
- "equiv;": '\U00002261',
- "equivDD;": '\U00002A78',
- "eqvparsl;": '\U000029E5',
- "erDot;": '\U00002253',
- "erarr;": '\U00002971',
- "escr;": '\U0000212F',
- "esdot;": '\U00002250',
- "esim;": '\U00002242',
- "eta;": '\U000003B7',
- "eth;": '\U000000F0',
- "euml;": '\U000000EB',
- "euro;": '\U000020AC',
- "excl;": '\U00000021',
- "exist;": '\U00002203',
- "expectation;": '\U00002130',
- "exponentiale;": '\U00002147',
- "fallingdotseq;": '\U00002252',
- "fcy;": '\U00000444',
- "female;": '\U00002640',
- "ffilig;": '\U0000FB03',
- "fflig;": '\U0000FB00',
- "ffllig;": '\U0000FB04',
- "ffr;": '\U0001D523',
- "filig;": '\U0000FB01',
- "flat;": '\U0000266D',
- "fllig;": '\U0000FB02',
- "fltns;": '\U000025B1',
- "fnof;": '\U00000192',
- "fopf;": '\U0001D557',
- "forall;": '\U00002200',
- "fork;": '\U000022D4',
- "forkv;": '\U00002AD9',
- "fpartint;": '\U00002A0D',
- "frac12;": '\U000000BD',
- "frac13;": '\U00002153',
- "frac14;": '\U000000BC',
- "frac15;": '\U00002155',
- "frac16;": '\U00002159',
- "frac18;": '\U0000215B',
- "frac23;": '\U00002154',
- "frac25;": '\U00002156',
- "frac34;": '\U000000BE',
- "frac35;": '\U00002157',
- "frac38;": '\U0000215C',
- "frac45;": '\U00002158',
- "frac56;": '\U0000215A',
- "frac58;": '\U0000215D',
- "frac78;": '\U0000215E',
- "frasl;": '\U00002044',
- "frown;": '\U00002322',
- "fscr;": '\U0001D4BB',
- "gE;": '\U00002267',
- "gEl;": '\U00002A8C',
- "gacute;": '\U000001F5',
- "gamma;": '\U000003B3',
- "gammad;": '\U000003DD',
- "gap;": '\U00002A86',
- "gbreve;": '\U0000011F',
- "gcirc;": '\U0000011D',
- "gcy;": '\U00000433',
- "gdot;": '\U00000121',
- "ge;": '\U00002265',
- "gel;": '\U000022DB',
- "geq;": '\U00002265',
- "geqq;": '\U00002267',
- "geqslant;": '\U00002A7E',
- "ges;": '\U00002A7E',
- "gescc;": '\U00002AA9',
- "gesdot;": '\U00002A80',
- "gesdoto;": '\U00002A82',
- "gesdotol;": '\U00002A84',
- "gesles;": '\U00002A94',
- "gfr;": '\U0001D524',
- "gg;": '\U0000226B',
- "ggg;": '\U000022D9',
- "gimel;": '\U00002137',
- "gjcy;": '\U00000453',
- "gl;": '\U00002277',
- "glE;": '\U00002A92',
- "gla;": '\U00002AA5',
- "glj;": '\U00002AA4',
- "gnE;": '\U00002269',
- "gnap;": '\U00002A8A',
- "gnapprox;": '\U00002A8A',
- "gne;": '\U00002A88',
- "gneq;": '\U00002A88',
- "gneqq;": '\U00002269',
- "gnsim;": '\U000022E7',
- "gopf;": '\U0001D558',
- "grave;": '\U00000060',
- "gscr;": '\U0000210A',
- "gsim;": '\U00002273',
- "gsime;": '\U00002A8E',
- "gsiml;": '\U00002A90',
- "gt;": '\U0000003E',
- "gtcc;": '\U00002AA7',
- "gtcir;": '\U00002A7A',
- "gtdot;": '\U000022D7',
- "gtlPar;": '\U00002995',
- "gtquest;": '\U00002A7C',
- "gtrapprox;": '\U00002A86',
- "gtrarr;": '\U00002978',
- "gtrdot;": '\U000022D7',
- "gtreqless;": '\U000022DB',
- "gtreqqless;": '\U00002A8C',
- "gtrless;": '\U00002277',
- "gtrsim;": '\U00002273',
- "hArr;": '\U000021D4',
- "hairsp;": '\U0000200A',
- "half;": '\U000000BD',
- "hamilt;": '\U0000210B',
- "hardcy;": '\U0000044A',
- "harr;": '\U00002194',
- "harrcir;": '\U00002948',
- "harrw;": '\U000021AD',
- "hbar;": '\U0000210F',
- "hcirc;": '\U00000125',
- "hearts;": '\U00002665',
- "heartsuit;": '\U00002665',
- "hellip;": '\U00002026',
- "hercon;": '\U000022B9',
- "hfr;": '\U0001D525',
- "hksearow;": '\U00002925',
- "hkswarow;": '\U00002926',
- "hoarr;": '\U000021FF',
- "homtht;": '\U0000223B',
- "hookleftarrow;": '\U000021A9',
- "hookrightarrow;": '\U000021AA',
- "hopf;": '\U0001D559',
- "horbar;": '\U00002015',
- "hscr;": '\U0001D4BD',
- "hslash;": '\U0000210F',
- "hstrok;": '\U00000127',
- "hybull;": '\U00002043',
- "hyphen;": '\U00002010',
- "iacute;": '\U000000ED',
- "ic;": '\U00002063',
- "icirc;": '\U000000EE',
- "icy;": '\U00000438',
- "iecy;": '\U00000435',
- "iexcl;": '\U000000A1',
- "iff;": '\U000021D4',
- "ifr;": '\U0001D526',
- "igrave;": '\U000000EC',
- "ii;": '\U00002148',
- "iiiint;": '\U00002A0C',
- "iiint;": '\U0000222D',
- "iinfin;": '\U000029DC',
- "iiota;": '\U00002129',
- "ijlig;": '\U00000133',
- "imacr;": '\U0000012B',
- "image;": '\U00002111',
- "imagline;": '\U00002110',
- "imagpart;": '\U00002111',
- "imath;": '\U00000131',
- "imof;": '\U000022B7',
- "imped;": '\U000001B5',
- "in;": '\U00002208',
- "incare;": '\U00002105',
- "infin;": '\U0000221E',
- "infintie;": '\U000029DD',
- "inodot;": '\U00000131',
- "int;": '\U0000222B',
- "intcal;": '\U000022BA',
- "integers;": '\U00002124',
- "intercal;": '\U000022BA',
- "intlarhk;": '\U00002A17',
- "intprod;": '\U00002A3C',
- "iocy;": '\U00000451',
- "iogon;": '\U0000012F',
- "iopf;": '\U0001D55A',
- "iota;": '\U000003B9',
- "iprod;": '\U00002A3C',
- "iquest;": '\U000000BF',
- "iscr;": '\U0001D4BE',
- "isin;": '\U00002208',
- "isinE;": '\U000022F9',
- "isindot;": '\U000022F5',
- "isins;": '\U000022F4',
- "isinsv;": '\U000022F3',
- "isinv;": '\U00002208',
- "it;": '\U00002062',
- "itilde;": '\U00000129',
- "iukcy;": '\U00000456',
- "iuml;": '\U000000EF',
- "jcirc;": '\U00000135',
- "jcy;": '\U00000439',
- "jfr;": '\U0001D527',
- "jmath;": '\U00000237',
- "jopf;": '\U0001D55B',
- "jscr;": '\U0001D4BF',
- "jsercy;": '\U00000458',
- "jukcy;": '\U00000454',
- "kappa;": '\U000003BA',
- "kappav;": '\U000003F0',
- "kcedil;": '\U00000137',
- "kcy;": '\U0000043A',
- "kfr;": '\U0001D528',
- "kgreen;": '\U00000138',
- "khcy;": '\U00000445',
- "kjcy;": '\U0000045C',
- "kopf;": '\U0001D55C',
- "kscr;": '\U0001D4C0',
- "lAarr;": '\U000021DA',
- "lArr;": '\U000021D0',
- "lAtail;": '\U0000291B',
- "lBarr;": '\U0000290E',
- "lE;": '\U00002266',
- "lEg;": '\U00002A8B',
- "lHar;": '\U00002962',
- "lacute;": '\U0000013A',
- "laemptyv;": '\U000029B4',
- "lagran;": '\U00002112',
- "lambda;": '\U000003BB',
- "lang;": '\U000027E8',
- "langd;": '\U00002991',
- "langle;": '\U000027E8',
- "lap;": '\U00002A85',
- "laquo;": '\U000000AB',
- "larr;": '\U00002190',
- "larrb;": '\U000021E4',
- "larrbfs;": '\U0000291F',
- "larrfs;": '\U0000291D',
- "larrhk;": '\U000021A9',
- "larrlp;": '\U000021AB',
- "larrpl;": '\U00002939',
- "larrsim;": '\U00002973',
- "larrtl;": '\U000021A2',
- "lat;": '\U00002AAB',
- "latail;": '\U00002919',
- "late;": '\U00002AAD',
- "lbarr;": '\U0000290C',
- "lbbrk;": '\U00002772',
- "lbrace;": '\U0000007B',
- "lbrack;": '\U0000005B',
- "lbrke;": '\U0000298B',
- "lbrksld;": '\U0000298F',
- "lbrkslu;": '\U0000298D',
- "lcaron;": '\U0000013E',
- "lcedil;": '\U0000013C',
- "lceil;": '\U00002308',
- "lcub;": '\U0000007B',
- "lcy;": '\U0000043B',
- "ldca;": '\U00002936',
- "ldquo;": '\U0000201C',
- "ldquor;": '\U0000201E',
- "ldrdhar;": '\U00002967',
- "ldrushar;": '\U0000294B',
- "ldsh;": '\U000021B2',
- "le;": '\U00002264',
- "leftarrow;": '\U00002190',
- "leftarrowtail;": '\U000021A2',
- "leftharpoondown;": '\U000021BD',
- "leftharpoonup;": '\U000021BC',
- "leftleftarrows;": '\U000021C7',
- "leftrightarrow;": '\U00002194',
- "leftrightarrows;": '\U000021C6',
- "leftrightharpoons;": '\U000021CB',
- "leftrightsquigarrow;": '\U000021AD',
- "leftthreetimes;": '\U000022CB',
- "leg;": '\U000022DA',
- "leq;": '\U00002264',
- "leqq;": '\U00002266',
- "leqslant;": '\U00002A7D',
- "les;": '\U00002A7D',
- "lescc;": '\U00002AA8',
- "lesdot;": '\U00002A7F',
- "lesdoto;": '\U00002A81',
- "lesdotor;": '\U00002A83',
- "lesges;": '\U00002A93',
- "lessapprox;": '\U00002A85',
- "lessdot;": '\U000022D6',
- "lesseqgtr;": '\U000022DA',
- "lesseqqgtr;": '\U00002A8B',
- "lessgtr;": '\U00002276',
- "lesssim;": '\U00002272',
- "lfisht;": '\U0000297C',
- "lfloor;": '\U0000230A',
- "lfr;": '\U0001D529',
- "lg;": '\U00002276',
- "lgE;": '\U00002A91',
- "lhard;": '\U000021BD',
- "lharu;": '\U000021BC',
- "lharul;": '\U0000296A',
- "lhblk;": '\U00002584',
- "ljcy;": '\U00000459',
- "ll;": '\U0000226A',
- "llarr;": '\U000021C7',
- "llcorner;": '\U0000231E',
- "llhard;": '\U0000296B',
- "lltri;": '\U000025FA',
- "lmidot;": '\U00000140',
- "lmoust;": '\U000023B0',
- "lmoustache;": '\U000023B0',
- "lnE;": '\U00002268',
- "lnap;": '\U00002A89',
- "lnapprox;": '\U00002A89',
- "lne;": '\U00002A87',
- "lneq;": '\U00002A87',
- "lneqq;": '\U00002268',
- "lnsim;": '\U000022E6',
- "loang;": '\U000027EC',
- "loarr;": '\U000021FD',
- "lobrk;": '\U000027E6',
- "longleftarrow;": '\U000027F5',
- "longleftrightarrow;": '\U000027F7',
- "longmapsto;": '\U000027FC',
- "longrightarrow;": '\U000027F6',
- "looparrowleft;": '\U000021AB',
- "looparrowright;": '\U000021AC',
- "lopar;": '\U00002985',
- "lopf;": '\U0001D55D',
- "loplus;": '\U00002A2D',
- "lotimes;": '\U00002A34',
- "lowast;": '\U00002217',
- "lowbar;": '\U0000005F',
- "loz;": '\U000025CA',
- "lozenge;": '\U000025CA',
- "lozf;": '\U000029EB',
- "lpar;": '\U00000028',
- "lparlt;": '\U00002993',
- "lrarr;": '\U000021C6',
- "lrcorner;": '\U0000231F',
- "lrhar;": '\U000021CB',
- "lrhard;": '\U0000296D',
- "lrm;": '\U0000200E',
- "lrtri;": '\U000022BF',
- "lsaquo;": '\U00002039',
- "lscr;": '\U0001D4C1',
- "lsh;": '\U000021B0',
- "lsim;": '\U00002272',
- "lsime;": '\U00002A8D',
- "lsimg;": '\U00002A8F',
- "lsqb;": '\U0000005B',
- "lsquo;": '\U00002018',
- "lsquor;": '\U0000201A',
- "lstrok;": '\U00000142',
- "lt;": '\U0000003C',
- "ltcc;": '\U00002AA6',
- "ltcir;": '\U00002A79',
- "ltdot;": '\U000022D6',
- "lthree;": '\U000022CB',
- "ltimes;": '\U000022C9',
- "ltlarr;": '\U00002976',
- "ltquest;": '\U00002A7B',
- "ltrPar;": '\U00002996',
- "ltri;": '\U000025C3',
- "ltrie;": '\U000022B4',
- "ltrif;": '\U000025C2',
- "lurdshar;": '\U0000294A',
- "luruhar;": '\U00002966',
- "mDDot;": '\U0000223A',
- "macr;": '\U000000AF',
- "male;": '\U00002642',
- "malt;": '\U00002720',
- "maltese;": '\U00002720',
- "map;": '\U000021A6',
- "mapsto;": '\U000021A6',
- "mapstodown;": '\U000021A7',
- "mapstoleft;": '\U000021A4',
- "mapstoup;": '\U000021A5',
- "marker;": '\U000025AE',
- "mcomma;": '\U00002A29',
- "mcy;": '\U0000043C',
- "mdash;": '\U00002014',
- "measuredangle;": '\U00002221',
- "mfr;": '\U0001D52A',
- "mho;": '\U00002127',
- "micro;": '\U000000B5',
- "mid;": '\U00002223',
- "midast;": '\U0000002A',
- "midcir;": '\U00002AF0',
- "middot;": '\U000000B7',
- "minus;": '\U00002212',
- "minusb;": '\U0000229F',
- "minusd;": '\U00002238',
- "minusdu;": '\U00002A2A',
- "mlcp;": '\U00002ADB',
- "mldr;": '\U00002026',
- "mnplus;": '\U00002213',
- "models;": '\U000022A7',
- "mopf;": '\U0001D55E',
- "mp;": '\U00002213',
- "mscr;": '\U0001D4C2',
- "mstpos;": '\U0000223E',
- "mu;": '\U000003BC',
- "multimap;": '\U000022B8',
- "mumap;": '\U000022B8',
- "nLeftarrow;": '\U000021CD',
- "nLeftrightarrow;": '\U000021CE',
- "nRightarrow;": '\U000021CF',
- "nVDash;": '\U000022AF',
- "nVdash;": '\U000022AE',
- "nabla;": '\U00002207',
- "nacute;": '\U00000144',
- "nap;": '\U00002249',
- "napos;": '\U00000149',
- "napprox;": '\U00002249',
- "natur;": '\U0000266E',
- "natural;": '\U0000266E',
- "naturals;": '\U00002115',
- "nbsp;": '\U000000A0',
- "ncap;": '\U00002A43',
- "ncaron;": '\U00000148',
- "ncedil;": '\U00000146',
- "ncong;": '\U00002247',
- "ncup;": '\U00002A42',
- "ncy;": '\U0000043D',
- "ndash;": '\U00002013',
- "ne;": '\U00002260',
- "neArr;": '\U000021D7',
- "nearhk;": '\U00002924',
- "nearr;": '\U00002197',
- "nearrow;": '\U00002197',
- "nequiv;": '\U00002262',
- "nesear;": '\U00002928',
- "nexist;": '\U00002204',
- "nexists;": '\U00002204',
- "nfr;": '\U0001D52B',
- "nge;": '\U00002271',
- "ngeq;": '\U00002271',
- "ngsim;": '\U00002275',
- "ngt;": '\U0000226F',
- "ngtr;": '\U0000226F',
- "nhArr;": '\U000021CE',
- "nharr;": '\U000021AE',
- "nhpar;": '\U00002AF2',
- "ni;": '\U0000220B',
- "nis;": '\U000022FC',
- "nisd;": '\U000022FA',
- "niv;": '\U0000220B',
- "njcy;": '\U0000045A',
- "nlArr;": '\U000021CD',
- "nlarr;": '\U0000219A',
- "nldr;": '\U00002025',
- "nle;": '\U00002270',
- "nleftarrow;": '\U0000219A',
- "nleftrightarrow;": '\U000021AE',
- "nleq;": '\U00002270',
- "nless;": '\U0000226E',
- "nlsim;": '\U00002274',
- "nlt;": '\U0000226E',
- "nltri;": '\U000022EA',
- "nltrie;": '\U000022EC',
- "nmid;": '\U00002224',
- "nopf;": '\U0001D55F',
- "not;": '\U000000AC',
- "notin;": '\U00002209',
- "notinva;": '\U00002209',
- "notinvb;": '\U000022F7',
- "notinvc;": '\U000022F6',
- "notni;": '\U0000220C',
- "notniva;": '\U0000220C',
- "notnivb;": '\U000022FE',
- "notnivc;": '\U000022FD',
- "npar;": '\U00002226',
- "nparallel;": '\U00002226',
- "npolint;": '\U00002A14',
- "npr;": '\U00002280',
- "nprcue;": '\U000022E0',
- "nprec;": '\U00002280',
- "nrArr;": '\U000021CF',
- "nrarr;": '\U0000219B',
- "nrightarrow;": '\U0000219B',
- "nrtri;": '\U000022EB',
- "nrtrie;": '\U000022ED',
- "nsc;": '\U00002281',
- "nsccue;": '\U000022E1',
- "nscr;": '\U0001D4C3',
- "nshortmid;": '\U00002224',
- "nshortparallel;": '\U00002226',
- "nsim;": '\U00002241',
- "nsime;": '\U00002244',
- "nsimeq;": '\U00002244',
- "nsmid;": '\U00002224',
- "nspar;": '\U00002226',
- "nsqsube;": '\U000022E2',
- "nsqsupe;": '\U000022E3',
- "nsub;": '\U00002284',
- "nsube;": '\U00002288',
- "nsubseteq;": '\U00002288',
- "nsucc;": '\U00002281',
- "nsup;": '\U00002285',
- "nsupe;": '\U00002289',
- "nsupseteq;": '\U00002289',
- "ntgl;": '\U00002279',
- "ntilde;": '\U000000F1',
- "ntlg;": '\U00002278',
- "ntriangleleft;": '\U000022EA',
- "ntrianglelefteq;": '\U000022EC',
- "ntriangleright;": '\U000022EB',
- "ntrianglerighteq;": '\U000022ED',
- "nu;": '\U000003BD',
- "num;": '\U00000023',
- "numero;": '\U00002116',
- "numsp;": '\U00002007',
- "nvDash;": '\U000022AD',
- "nvHarr;": '\U00002904',
- "nvdash;": '\U000022AC',
- "nvinfin;": '\U000029DE',
- "nvlArr;": '\U00002902',
- "nvrArr;": '\U00002903',
- "nwArr;": '\U000021D6',
- "nwarhk;": '\U00002923',
- "nwarr;": '\U00002196',
- "nwarrow;": '\U00002196',
- "nwnear;": '\U00002927',
- "oS;": '\U000024C8',
- "oacute;": '\U000000F3',
- "oast;": '\U0000229B',
- "ocir;": '\U0000229A',
- "ocirc;": '\U000000F4',
- "ocy;": '\U0000043E',
- "odash;": '\U0000229D',
- "odblac;": '\U00000151',
- "odiv;": '\U00002A38',
- "odot;": '\U00002299',
- "odsold;": '\U000029BC',
- "oelig;": '\U00000153',
- "ofcir;": '\U000029BF',
- "ofr;": '\U0001D52C',
- "ogon;": '\U000002DB',
- "ograve;": '\U000000F2',
- "ogt;": '\U000029C1',
- "ohbar;": '\U000029B5',
- "ohm;": '\U000003A9',
- "oint;": '\U0000222E',
- "olarr;": '\U000021BA',
- "olcir;": '\U000029BE',
- "olcross;": '\U000029BB',
- "oline;": '\U0000203E',
- "olt;": '\U000029C0',
- "omacr;": '\U0000014D',
- "omega;": '\U000003C9',
- "omicron;": '\U000003BF',
- "omid;": '\U000029B6',
- "ominus;": '\U00002296',
- "oopf;": '\U0001D560',
- "opar;": '\U000029B7',
- "operp;": '\U000029B9',
- "oplus;": '\U00002295',
- "or;": '\U00002228',
- "orarr;": '\U000021BB',
- "ord;": '\U00002A5D',
- "order;": '\U00002134',
- "orderof;": '\U00002134',
- "ordf;": '\U000000AA',
- "ordm;": '\U000000BA',
- "origof;": '\U000022B6',
- "oror;": '\U00002A56',
- "orslope;": '\U00002A57',
- "orv;": '\U00002A5B',
- "oscr;": '\U00002134',
- "oslash;": '\U000000F8',
- "osol;": '\U00002298',
- "otilde;": '\U000000F5',
- "otimes;": '\U00002297',
- "otimesas;": '\U00002A36',
- "ouml;": '\U000000F6',
- "ovbar;": '\U0000233D',
- "par;": '\U00002225',
- "para;": '\U000000B6',
- "parallel;": '\U00002225',
- "parsim;": '\U00002AF3',
- "parsl;": '\U00002AFD',
- "part;": '\U00002202',
- "pcy;": '\U0000043F',
- "percnt;": '\U00000025',
- "period;": '\U0000002E',
- "permil;": '\U00002030',
- "perp;": '\U000022A5',
- "pertenk;": '\U00002031',
- "pfr;": '\U0001D52D',
- "phi;": '\U000003C6',
- "phiv;": '\U000003D5',
- "phmmat;": '\U00002133',
- "phone;": '\U0000260E',
- "pi;": '\U000003C0',
- "pitchfork;": '\U000022D4',
- "piv;": '\U000003D6',
- "planck;": '\U0000210F',
- "planckh;": '\U0000210E',
- "plankv;": '\U0000210F',
- "plus;": '\U0000002B',
- "plusacir;": '\U00002A23',
- "plusb;": '\U0000229E',
- "pluscir;": '\U00002A22',
- "plusdo;": '\U00002214',
- "plusdu;": '\U00002A25',
- "pluse;": '\U00002A72',
- "plusmn;": '\U000000B1',
- "plussim;": '\U00002A26',
- "plustwo;": '\U00002A27',
- "pm;": '\U000000B1',
- "pointint;": '\U00002A15',
- "popf;": '\U0001D561',
- "pound;": '\U000000A3',
- "pr;": '\U0000227A',
- "prE;": '\U00002AB3',
- "prap;": '\U00002AB7',
- "prcue;": '\U0000227C',
- "pre;": '\U00002AAF',
- "prec;": '\U0000227A',
- "precapprox;": '\U00002AB7',
- "preccurlyeq;": '\U0000227C',
- "preceq;": '\U00002AAF',
- "precnapprox;": '\U00002AB9',
- "precneqq;": '\U00002AB5',
- "precnsim;": '\U000022E8',
- "precsim;": '\U0000227E',
- "prime;": '\U00002032',
- "primes;": '\U00002119',
- "prnE;": '\U00002AB5',
- "prnap;": '\U00002AB9',
- "prnsim;": '\U000022E8',
- "prod;": '\U0000220F',
- "profalar;": '\U0000232E',
- "profline;": '\U00002312',
- "profsurf;": '\U00002313',
- "prop;": '\U0000221D',
- "propto;": '\U0000221D',
- "prsim;": '\U0000227E',
- "prurel;": '\U000022B0',
- "pscr;": '\U0001D4C5',
- "psi;": '\U000003C8',
- "puncsp;": '\U00002008',
- "qfr;": '\U0001D52E',
- "qint;": '\U00002A0C',
- "qopf;": '\U0001D562',
- "qprime;": '\U00002057',
- "qscr;": '\U0001D4C6',
- "quaternions;": '\U0000210D',
- "quatint;": '\U00002A16',
- "quest;": '\U0000003F',
- "questeq;": '\U0000225F',
- "quot;": '\U00000022',
- "rAarr;": '\U000021DB',
- "rArr;": '\U000021D2',
- "rAtail;": '\U0000291C',
- "rBarr;": '\U0000290F',
- "rHar;": '\U00002964',
- "racute;": '\U00000155',
- "radic;": '\U0000221A',
- "raemptyv;": '\U000029B3',
- "rang;": '\U000027E9',
- "rangd;": '\U00002992',
- "range;": '\U000029A5',
- "rangle;": '\U000027E9',
- "raquo;": '\U000000BB',
- "rarr;": '\U00002192',
- "rarrap;": '\U00002975',
- "rarrb;": '\U000021E5',
- "rarrbfs;": '\U00002920',
- "rarrc;": '\U00002933',
- "rarrfs;": '\U0000291E',
- "rarrhk;": '\U000021AA',
- "rarrlp;": '\U000021AC',
- "rarrpl;": '\U00002945',
- "rarrsim;": '\U00002974',
- "rarrtl;": '\U000021A3',
- "rarrw;": '\U0000219D',
- "ratail;": '\U0000291A',
- "ratio;": '\U00002236',
- "rationals;": '\U0000211A',
- "rbarr;": '\U0000290D',
- "rbbrk;": '\U00002773',
- "rbrace;": '\U0000007D',
- "rbrack;": '\U0000005D',
- "rbrke;": '\U0000298C',
- "rbrksld;": '\U0000298E',
- "rbrkslu;": '\U00002990',
- "rcaron;": '\U00000159',
- "rcedil;": '\U00000157',
- "rceil;": '\U00002309',
- "rcub;": '\U0000007D',
- "rcy;": '\U00000440',
- "rdca;": '\U00002937',
- "rdldhar;": '\U00002969',
- "rdquo;": '\U0000201D',
- "rdquor;": '\U0000201D',
- "rdsh;": '\U000021B3',
- "real;": '\U0000211C',
- "realine;": '\U0000211B',
- "realpart;": '\U0000211C',
- "reals;": '\U0000211D',
- "rect;": '\U000025AD',
- "reg;": '\U000000AE',
- "rfisht;": '\U0000297D',
- "rfloor;": '\U0000230B',
- "rfr;": '\U0001D52F',
- "rhard;": '\U000021C1',
- "rharu;": '\U000021C0',
- "rharul;": '\U0000296C',
- "rho;": '\U000003C1',
- "rhov;": '\U000003F1',
- "rightarrow;": '\U00002192',
- "rightarrowtail;": '\U000021A3',
- "rightharpoondown;": '\U000021C1',
- "rightharpoonup;": '\U000021C0',
- "rightleftarrows;": '\U000021C4',
- "rightleftharpoons;": '\U000021CC',
- "rightrightarrows;": '\U000021C9',
- "rightsquigarrow;": '\U0000219D',
- "rightthreetimes;": '\U000022CC',
- "ring;": '\U000002DA',
- "risingdotseq;": '\U00002253',
- "rlarr;": '\U000021C4',
- "rlhar;": '\U000021CC',
- "rlm;": '\U0000200F',
- "rmoust;": '\U000023B1',
- "rmoustache;": '\U000023B1',
- "rnmid;": '\U00002AEE',
- "roang;": '\U000027ED',
- "roarr;": '\U000021FE',
- "robrk;": '\U000027E7',
- "ropar;": '\U00002986',
- "ropf;": '\U0001D563',
- "roplus;": '\U00002A2E',
- "rotimes;": '\U00002A35',
- "rpar;": '\U00000029',
- "rpargt;": '\U00002994',
- "rppolint;": '\U00002A12',
- "rrarr;": '\U000021C9',
- "rsaquo;": '\U0000203A',
- "rscr;": '\U0001D4C7',
- "rsh;": '\U000021B1',
- "rsqb;": '\U0000005D',
- "rsquo;": '\U00002019',
- "rsquor;": '\U00002019',
- "rthree;": '\U000022CC',
- "rtimes;": '\U000022CA',
- "rtri;": '\U000025B9',
- "rtrie;": '\U000022B5',
- "rtrif;": '\U000025B8',
- "rtriltri;": '\U000029CE',
- "ruluhar;": '\U00002968',
- "rx;": '\U0000211E',
- "sacute;": '\U0000015B',
- "sbquo;": '\U0000201A',
- "sc;": '\U0000227B',
- "scE;": '\U00002AB4',
- "scap;": '\U00002AB8',
- "scaron;": '\U00000161',
- "sccue;": '\U0000227D',
- "sce;": '\U00002AB0',
- "scedil;": '\U0000015F',
- "scirc;": '\U0000015D',
- "scnE;": '\U00002AB6',
- "scnap;": '\U00002ABA',
- "scnsim;": '\U000022E9',
- "scpolint;": '\U00002A13',
- "scsim;": '\U0000227F',
- "scy;": '\U00000441',
- "sdot;": '\U000022C5',
- "sdotb;": '\U000022A1',
- "sdote;": '\U00002A66',
- "seArr;": '\U000021D8',
- "searhk;": '\U00002925',
- "searr;": '\U00002198',
- "searrow;": '\U00002198',
- "sect;": '\U000000A7',
- "semi;": '\U0000003B',
- "seswar;": '\U00002929',
- "setminus;": '\U00002216',
- "setmn;": '\U00002216',
- "sext;": '\U00002736',
- "sfr;": '\U0001D530',
- "sfrown;": '\U00002322',
- "sharp;": '\U0000266F',
- "shchcy;": '\U00000449',
- "shcy;": '\U00000448',
- "shortmid;": '\U00002223',
- "shortparallel;": '\U00002225',
- "shy;": '\U000000AD',
- "sigma;": '\U000003C3',
- "sigmaf;": '\U000003C2',
- "sigmav;": '\U000003C2',
- "sim;": '\U0000223C',
- "simdot;": '\U00002A6A',
- "sime;": '\U00002243',
- "simeq;": '\U00002243',
- "simg;": '\U00002A9E',
- "simgE;": '\U00002AA0',
- "siml;": '\U00002A9D',
- "simlE;": '\U00002A9F',
- "simne;": '\U00002246',
- "simplus;": '\U00002A24',
- "simrarr;": '\U00002972',
- "slarr;": '\U00002190',
- "smallsetminus;": '\U00002216',
- "smashp;": '\U00002A33',
- "smeparsl;": '\U000029E4',
- "smid;": '\U00002223',
- "smile;": '\U00002323',
- "smt;": '\U00002AAA',
- "smte;": '\U00002AAC',
- "softcy;": '\U0000044C',
- "sol;": '\U0000002F',
- "solb;": '\U000029C4',
- "solbar;": '\U0000233F',
- "sopf;": '\U0001D564',
- "spades;": '\U00002660',
- "spadesuit;": '\U00002660',
- "spar;": '\U00002225',
- "sqcap;": '\U00002293',
- "sqcup;": '\U00002294',
- "sqsub;": '\U0000228F',
- "sqsube;": '\U00002291',
- "sqsubset;": '\U0000228F',
- "sqsubseteq;": '\U00002291',
- "sqsup;": '\U00002290',
- "sqsupe;": '\U00002292',
- "sqsupset;": '\U00002290',
- "sqsupseteq;": '\U00002292',
- "squ;": '\U000025A1',
- "square;": '\U000025A1',
- "squarf;": '\U000025AA',
- "squf;": '\U000025AA',
- "srarr;": '\U00002192',
- "sscr;": '\U0001D4C8',
- "ssetmn;": '\U00002216',
- "ssmile;": '\U00002323',
- "sstarf;": '\U000022C6',
- "star;": '\U00002606',
- "starf;": '\U00002605',
- "straightepsilon;": '\U000003F5',
- "straightphi;": '\U000003D5',
- "strns;": '\U000000AF',
- "sub;": '\U00002282',
- "subE;": '\U00002AC5',
- "subdot;": '\U00002ABD',
- "sube;": '\U00002286',
- "subedot;": '\U00002AC3',
- "submult;": '\U00002AC1',
- "subnE;": '\U00002ACB',
- "subne;": '\U0000228A',
- "subplus;": '\U00002ABF',
- "subrarr;": '\U00002979',
- "subset;": '\U00002282',
- "subseteq;": '\U00002286',
- "subseteqq;": '\U00002AC5',
- "subsetneq;": '\U0000228A',
- "subsetneqq;": '\U00002ACB',
- "subsim;": '\U00002AC7',
- "subsub;": '\U00002AD5',
- "subsup;": '\U00002AD3',
- "succ;": '\U0000227B',
- "succapprox;": '\U00002AB8',
- "succcurlyeq;": '\U0000227D',
- "succeq;": '\U00002AB0',
- "succnapprox;": '\U00002ABA',
- "succneqq;": '\U00002AB6',
- "succnsim;": '\U000022E9',
- "succsim;": '\U0000227F',
- "sum;": '\U00002211',
- "sung;": '\U0000266A',
- "sup;": '\U00002283',
- "sup1;": '\U000000B9',
- "sup2;": '\U000000B2',
- "sup3;": '\U000000B3',
- "supE;": '\U00002AC6',
- "supdot;": '\U00002ABE',
- "supdsub;": '\U00002AD8',
- "supe;": '\U00002287',
- "supedot;": '\U00002AC4',
- "suphsol;": '\U000027C9',
- "suphsub;": '\U00002AD7',
- "suplarr;": '\U0000297B',
- "supmult;": '\U00002AC2',
- "supnE;": '\U00002ACC',
- "supne;": '\U0000228B',
- "supplus;": '\U00002AC0',
- "supset;": '\U00002283',
- "supseteq;": '\U00002287',
- "supseteqq;": '\U00002AC6',
- "supsetneq;": '\U0000228B',
- "supsetneqq;": '\U00002ACC',
- "supsim;": '\U00002AC8',
- "supsub;": '\U00002AD4',
- "supsup;": '\U00002AD6',
- "swArr;": '\U000021D9',
- "swarhk;": '\U00002926',
- "swarr;": '\U00002199',
- "swarrow;": '\U00002199',
- "swnwar;": '\U0000292A',
- "szlig;": '\U000000DF',
- "target;": '\U00002316',
- "tau;": '\U000003C4',
- "tbrk;": '\U000023B4',
- "tcaron;": '\U00000165',
- "tcedil;": '\U00000163',
- "tcy;": '\U00000442',
- "tdot;": '\U000020DB',
- "telrec;": '\U00002315',
- "tfr;": '\U0001D531',
- "there4;": '\U00002234',
- "therefore;": '\U00002234',
- "theta;": '\U000003B8',
- "thetasym;": '\U000003D1',
- "thetav;": '\U000003D1',
- "thickapprox;": '\U00002248',
- "thicksim;": '\U0000223C',
- "thinsp;": '\U00002009',
- "thkap;": '\U00002248',
- "thksim;": '\U0000223C',
- "thorn;": '\U000000FE',
- "tilde;": '\U000002DC',
- "times;": '\U000000D7',
- "timesb;": '\U000022A0',
- "timesbar;": '\U00002A31',
- "timesd;": '\U00002A30',
- "tint;": '\U0000222D',
- "toea;": '\U00002928',
- "top;": '\U000022A4',
- "topbot;": '\U00002336',
- "topcir;": '\U00002AF1',
- "topf;": '\U0001D565',
- "topfork;": '\U00002ADA',
- "tosa;": '\U00002929',
- "tprime;": '\U00002034',
- "trade;": '\U00002122',
- "triangle;": '\U000025B5',
- "triangledown;": '\U000025BF',
- "triangleleft;": '\U000025C3',
- "trianglelefteq;": '\U000022B4',
- "triangleq;": '\U0000225C',
- "triangleright;": '\U000025B9',
- "trianglerighteq;": '\U000022B5',
- "tridot;": '\U000025EC',
- "trie;": '\U0000225C',
- "triminus;": '\U00002A3A',
- "triplus;": '\U00002A39',
- "trisb;": '\U000029CD',
- "tritime;": '\U00002A3B',
- "trpezium;": '\U000023E2',
- "tscr;": '\U0001D4C9',
- "tscy;": '\U00000446',
- "tshcy;": '\U0000045B',
- "tstrok;": '\U00000167',
- "twixt;": '\U0000226C',
- "twoheadleftarrow;": '\U0000219E',
- "twoheadrightarrow;": '\U000021A0',
- "uArr;": '\U000021D1',
- "uHar;": '\U00002963',
- "uacute;": '\U000000FA',
- "uarr;": '\U00002191',
- "ubrcy;": '\U0000045E',
- "ubreve;": '\U0000016D',
- "ucirc;": '\U000000FB',
- "ucy;": '\U00000443',
- "udarr;": '\U000021C5',
- "udblac;": '\U00000171',
- "udhar;": '\U0000296E',
- "ufisht;": '\U0000297E',
- "ufr;": '\U0001D532',
- "ugrave;": '\U000000F9',
- "uharl;": '\U000021BF',
- "uharr;": '\U000021BE',
- "uhblk;": '\U00002580',
- "ulcorn;": '\U0000231C',
- "ulcorner;": '\U0000231C',
- "ulcrop;": '\U0000230F',
- "ultri;": '\U000025F8',
- "umacr;": '\U0000016B',
- "uml;": '\U000000A8',
- "uogon;": '\U00000173',
- "uopf;": '\U0001D566',
- "uparrow;": '\U00002191',
- "updownarrow;": '\U00002195',
- "upharpoonleft;": '\U000021BF',
- "upharpoonright;": '\U000021BE',
- "uplus;": '\U0000228E',
- "upsi;": '\U000003C5',
- "upsih;": '\U000003D2',
- "upsilon;": '\U000003C5',
- "upuparrows;": '\U000021C8',
- "urcorn;": '\U0000231D',
- "urcorner;": '\U0000231D',
- "urcrop;": '\U0000230E',
- "uring;": '\U0000016F',
- "urtri;": '\U000025F9',
- "uscr;": '\U0001D4CA',
- "utdot;": '\U000022F0',
- "utilde;": '\U00000169',
- "utri;": '\U000025B5',
- "utrif;": '\U000025B4',
- "uuarr;": '\U000021C8',
- "uuml;": '\U000000FC',
- "uwangle;": '\U000029A7',
- "vArr;": '\U000021D5',
- "vBar;": '\U00002AE8',
- "vBarv;": '\U00002AE9',
- "vDash;": '\U000022A8',
- "vangrt;": '\U0000299C',
- "varepsilon;": '\U000003F5',
- "varkappa;": '\U000003F0',
- "varnothing;": '\U00002205',
- "varphi;": '\U000003D5',
- "varpi;": '\U000003D6',
- "varpropto;": '\U0000221D',
- "varr;": '\U00002195',
- "varrho;": '\U000003F1',
- "varsigma;": '\U000003C2',
- "vartheta;": '\U000003D1',
- "vartriangleleft;": '\U000022B2',
- "vartriangleright;": '\U000022B3',
- "vcy;": '\U00000432',
- "vdash;": '\U000022A2',
- "vee;": '\U00002228',
- "veebar;": '\U000022BB',
- "veeeq;": '\U0000225A',
- "vellip;": '\U000022EE',
- "verbar;": '\U0000007C',
- "vert;": '\U0000007C',
- "vfr;": '\U0001D533',
- "vltri;": '\U000022B2',
- "vopf;": '\U0001D567',
- "vprop;": '\U0000221D',
- "vrtri;": '\U000022B3',
- "vscr;": '\U0001D4CB',
- "vzigzag;": '\U0000299A',
- "wcirc;": '\U00000175',
- "wedbar;": '\U00002A5F',
- "wedge;": '\U00002227',
- "wedgeq;": '\U00002259',
- "weierp;": '\U00002118',
- "wfr;": '\U0001D534',
- "wopf;": '\U0001D568',
- "wp;": '\U00002118',
- "wr;": '\U00002240',
- "wreath;": '\U00002240',
- "wscr;": '\U0001D4CC',
- "xcap;": '\U000022C2',
- "xcirc;": '\U000025EF',
- "xcup;": '\U000022C3',
- "xdtri;": '\U000025BD',
- "xfr;": '\U0001D535',
- "xhArr;": '\U000027FA',
- "xharr;": '\U000027F7',
- "xi;": '\U000003BE',
- "xlArr;": '\U000027F8',
- "xlarr;": '\U000027F5',
- "xmap;": '\U000027FC',
- "xnis;": '\U000022FB',
- "xodot;": '\U00002A00',
- "xopf;": '\U0001D569',
- "xoplus;": '\U00002A01',
- "xotime;": '\U00002A02',
- "xrArr;": '\U000027F9',
- "xrarr;": '\U000027F6',
- "xscr;": '\U0001D4CD',
- "xsqcup;": '\U00002A06',
- "xuplus;": '\U00002A04',
- "xutri;": '\U000025B3',
- "xvee;": '\U000022C1',
- "xwedge;": '\U000022C0',
- "yacute;": '\U000000FD',
- "yacy;": '\U0000044F',
- "ycirc;": '\U00000177',
- "ycy;": '\U0000044B',
- "yen;": '\U000000A5',
- "yfr;": '\U0001D536',
- "yicy;": '\U00000457',
- "yopf;": '\U0001D56A',
- "yscr;": '\U0001D4CE',
- "yucy;": '\U0000044E',
- "yuml;": '\U000000FF',
- "zacute;": '\U0000017A',
- "zcaron;": '\U0000017E',
- "zcy;": '\U00000437',
- "zdot;": '\U0000017C',
- "zeetrf;": '\U00002128',
- "zeta;": '\U000003B6',
- "zfr;": '\U0001D537',
- "zhcy;": '\U00000436',
- "zigrarr;": '\U000021DD',
- "zopf;": '\U0001D56B',
- "zscr;": '\U0001D4CF',
- "zwj;": '\U0000200D',
- "zwnj;": '\U0000200C',
- "AElig": '\U000000C6',
- "AMP": '\U00000026',
- "Aacute": '\U000000C1',
- "Acirc": '\U000000C2',
- "Agrave": '\U000000C0',
- "Aring": '\U000000C5',
- "Atilde": '\U000000C3',
- "Auml": '\U000000C4',
- "COPY": '\U000000A9',
- "Ccedil": '\U000000C7',
- "ETH": '\U000000D0',
- "Eacute": '\U000000C9',
- "Ecirc": '\U000000CA',
- "Egrave": '\U000000C8',
- "Euml": '\U000000CB',
- "GT": '\U0000003E',
- "Iacute": '\U000000CD',
- "Icirc": '\U000000CE',
- "Igrave": '\U000000CC',
- "Iuml": '\U000000CF',
- "LT": '\U0000003C',
- "Ntilde": '\U000000D1',
- "Oacute": '\U000000D3',
- "Ocirc": '\U000000D4',
- "Ograve": '\U000000D2',
- "Oslash": '\U000000D8',
- "Otilde": '\U000000D5',
- "Ouml": '\U000000D6',
- "QUOT": '\U00000022',
- "REG": '\U000000AE',
- "THORN": '\U000000DE',
- "Uacute": '\U000000DA',
- "Ucirc": '\U000000DB',
- "Ugrave": '\U000000D9',
- "Uuml": '\U000000DC',
- "Yacute": '\U000000DD',
- "aacute": '\U000000E1',
- "acirc": '\U000000E2',
- "acute": '\U000000B4',
- "aelig": '\U000000E6',
- "agrave": '\U000000E0',
- "amp": '\U00000026',
- "aring": '\U000000E5',
- "atilde": '\U000000E3',
- "auml": '\U000000E4',
- "brvbar": '\U000000A6',
- "ccedil": '\U000000E7',
- "cedil": '\U000000B8',
- "cent": '\U000000A2',
- "copy": '\U000000A9',
- "curren": '\U000000A4',
- "deg": '\U000000B0',
- "divide": '\U000000F7',
- "eacute": '\U000000E9',
- "ecirc": '\U000000EA',
- "egrave": '\U000000E8',
- "eth": '\U000000F0',
- "euml": '\U000000EB',
- "frac12": '\U000000BD',
- "frac14": '\U000000BC',
- "frac34": '\U000000BE',
- "gt": '\U0000003E',
- "iacute": '\U000000ED',
- "icirc": '\U000000EE',
- "iexcl": '\U000000A1',
- "igrave": '\U000000EC',
- "iquest": '\U000000BF',
- "iuml": '\U000000EF',
- "laquo": '\U000000AB',
- "lt": '\U0000003C',
- "macr": '\U000000AF',
- "micro": '\U000000B5',
- "middot": '\U000000B7',
- "nbsp": '\U000000A0',
- "not": '\U000000AC',
- "ntilde": '\U000000F1',
- "oacute": '\U000000F3',
- "ocirc": '\U000000F4',
- "ograve": '\U000000F2',
- "ordf": '\U000000AA',
- "ordm": '\U000000BA',
- "oslash": '\U000000F8',
- "otilde": '\U000000F5',
- "ouml": '\U000000F6',
- "para": '\U000000B6',
- "plusmn": '\U000000B1',
- "pound": '\U000000A3',
- "quot": '\U00000022',
- "raquo": '\U000000BB',
- "reg": '\U000000AE',
- "sect": '\U000000A7',
- "shy": '\U000000AD',
- "sup1": '\U000000B9',
- "sup2": '\U000000B2',
- "sup3": '\U000000B3',
- "szlig": '\U000000DF',
- "thorn": '\U000000FE',
- "times": '\U000000D7',
- "uacute": '\U000000FA',
- "ucirc": '\U000000FB',
- "ugrave": '\U000000F9',
- "uml": '\U000000A8',
- "uuml": '\U000000FC',
- "yacute": '\U000000FD',
- "yen": '\U000000A5',
- "yuml": '\U000000FF',
+ "Cross;": '\U00002A2F',
+ "Cscr;": '\U0001D49E',
+ "Cup;": '\U000022D3',
+ "CupCap;": '\U0000224D',
+ "DD;": '\U00002145',
+ "DDotrahd;": '\U00002911',
+ "DJcy;": '\U00000402',
+ "DScy;": '\U00000405',
+ "DZcy;": '\U0000040F',
+ "Dagger;": '\U00002021',
+ "Darr;": '\U000021A1',
+ "Dashv;": '\U00002AE4',
+ "Dcaron;": '\U0000010E',
+ "Dcy;": '\U00000414',
+ "Del;": '\U00002207',
+ "Delta;": '\U00000394',
+ "Dfr;": '\U0001D507',
+ "DiacriticalAcute;": '\U000000B4',
+ "DiacriticalDot;": '\U000002D9',
+ "DiacriticalDoubleAcute;": '\U000002DD',
+ "DiacriticalGrave;": '\U00000060',
+ "DiacriticalTilde;": '\U000002DC',
+ "Diamond;": '\U000022C4',
+ "DifferentialD;": '\U00002146',
+ "Dopf;": '\U0001D53B',
+ "Dot;": '\U000000A8',
+ "DotDot;": '\U000020DC',
+ "DotEqual;": '\U00002250',
+ "DoubleContourIntegral;": '\U0000222F',
+ "DoubleDot;": '\U000000A8',
+ "DoubleDownArrow;": '\U000021D3',
+ "DoubleLeftArrow;": '\U000021D0',
+ "DoubleLeftRightArrow;": '\U000021D4',
+ "DoubleLeftTee;": '\U00002AE4',
+ "DoubleLongLeftArrow;": '\U000027F8',
+ "DoubleLongLeftRightArrow;": '\U000027FA',
+ "DoubleLongRightArrow;": '\U000027F9',
+ "DoubleRightArrow;": '\U000021D2',
+ "DoubleRightTee;": '\U000022A8',
+ "DoubleUpArrow;": '\U000021D1',
+ "DoubleUpDownArrow;": '\U000021D5',
+ "DoubleVerticalBar;": '\U00002225',
+ "DownArrow;": '\U00002193',
+ "DownArrowBar;": '\U00002913',
+ "DownArrowUpArrow;": '\U000021F5',
+ "DownBreve;": '\U00000311',
+ "DownLeftRightVector;": '\U00002950',
+ "DownLeftTeeVector;": '\U0000295E',
+ "DownLeftVector;": '\U000021BD',
+ "DownLeftVectorBar;": '\U00002956',
+ "DownRightTeeVector;": '\U0000295F',
+ "DownRightVector;": '\U000021C1',
+ "DownRightVectorBar;": '\U00002957',
+ "DownTee;": '\U000022A4',
+ "DownTeeArrow;": '\U000021A7',
+ "Downarrow;": '\U000021D3',
+ "Dscr;": '\U0001D49F',
+ "Dstrok;": '\U00000110',
+ "ENG;": '\U0000014A',
+ "ETH;": '\U000000D0',
+ "Eacute;": '\U000000C9',
+ "Ecaron;": '\U0000011A',
+ "Ecirc;": '\U000000CA',
+ "Ecy;": '\U0000042D',
+ "Edot;": '\U00000116',
+ "Efr;": '\U0001D508',
+ "Egrave;": '\U000000C8',
+ "Element;": '\U00002208',
+ "Emacr;": '\U00000112',
+ "EmptySmallSquare;": '\U000025FB',
+ "EmptyVerySmallSquare;": '\U000025AB',
+ "Eogon;": '\U00000118',
+ "Eopf;": '\U0001D53C',
+ "Epsilon;": '\U00000395',
+ "Equal;": '\U00002A75',
+ "EqualTilde;": '\U00002242',
+ "Equilibrium;": '\U000021CC',
+ "Escr;": '\U00002130',
+ "Esim;": '\U00002A73',
+ "Eta;": '\U00000397',
+ "Euml;": '\U000000CB',
+ "Exists;": '\U00002203',
+ "ExponentialE;": '\U00002147',
+ "Fcy;": '\U00000424',
+ "Ffr;": '\U0001D509',
+ "FilledSmallSquare;": '\U000025FC',
+ "FilledVerySmallSquare;": '\U000025AA',
+ "Fopf;": '\U0001D53D',
+ "ForAll;": '\U00002200',
+ "Fouriertrf;": '\U00002131',
+ "Fscr;": '\U00002131',
+ "GJcy;": '\U00000403',
+ "GT;": '\U0000003E',
+ "Gamma;": '\U00000393',
+ "Gammad;": '\U000003DC',
+ "Gbreve;": '\U0000011E',
+ "Gcedil;": '\U00000122',
+ "Gcirc;": '\U0000011C',
+ "Gcy;": '\U00000413',
+ "Gdot;": '\U00000120',
+ "Gfr;": '\U0001D50A',
+ "Gg;": '\U000022D9',
+ "Gopf;": '\U0001D53E',
+ "GreaterEqual;": '\U00002265',
+ "GreaterEqualLess;": '\U000022DB',
+ "GreaterFullEqual;": '\U00002267',
+ "GreaterGreater;": '\U00002AA2',
+ "GreaterLess;": '\U00002277',
+ "GreaterSlantEqual;": '\U00002A7E',
+ "GreaterTilde;": '\U00002273',
+ "Gscr;": '\U0001D4A2',
+ "Gt;": '\U0000226B',
+ "HARDcy;": '\U0000042A',
+ "Hacek;": '\U000002C7',
+ "Hat;": '\U0000005E',
+ "Hcirc;": '\U00000124',
+ "Hfr;": '\U0000210C',
+ "HilbertSpace;": '\U0000210B',
+ "Hopf;": '\U0000210D',
+ "HorizontalLine;": '\U00002500',
+ "Hscr;": '\U0000210B',
+ "Hstrok;": '\U00000126',
+ "HumpDownHump;": '\U0000224E',
+ "HumpEqual;": '\U0000224F',
+ "IEcy;": '\U00000415',
+ "IJlig;": '\U00000132',
+ "IOcy;": '\U00000401',
+ "Iacute;": '\U000000CD',
+ "Icirc;": '\U000000CE',
+ "Icy;": '\U00000418',
+ "Idot;": '\U00000130',
+ "Ifr;": '\U00002111',
+ "Igrave;": '\U000000CC',
+ "Im;": '\U00002111',
+ "Imacr;": '\U0000012A',
+ "ImaginaryI;": '\U00002148',
+ "Implies;": '\U000021D2',
+ "Int;": '\U0000222C',
+ "Integral;": '\U0000222B',
+ "Intersection;": '\U000022C2',
+ "InvisibleComma;": '\U00002063',
+ "InvisibleTimes;": '\U00002062',
+ "Iogon;": '\U0000012E',
+ "Iopf;": '\U0001D540',
+ "Iota;": '\U00000399',
+ "Iscr;": '\U00002110',
+ "Itilde;": '\U00000128',
+ "Iukcy;": '\U00000406',
+ "Iuml;": '\U000000CF',
+ "Jcirc;": '\U00000134',
+ "Jcy;": '\U00000419',
+ "Jfr;": '\U0001D50D',
+ "Jopf;": '\U0001D541',
+ "Jscr;": '\U0001D4A5',
+ "Jsercy;": '\U00000408',
+ "Jukcy;": '\U00000404',
+ "KHcy;": '\U00000425',
+ "KJcy;": '\U0000040C',
+ "Kappa;": '\U0000039A',
+ "Kcedil;": '\U00000136',
+ "Kcy;": '\U0000041A',
+ "Kfr;": '\U0001D50E',
+ "Kopf;": '\U0001D542',
+ "Kscr;": '\U0001D4A6',
+ "LJcy;": '\U00000409',
+ "LT;": '\U0000003C',
+ "Lacute;": '\U00000139',
+ "Lambda;": '\U0000039B',
+ "Lang;": '\U000027EA',
+ "Laplacetrf;": '\U00002112',
+ "Larr;": '\U0000219E',
+ "Lcaron;": '\U0000013D',
+ "Lcedil;": '\U0000013B',
+ "Lcy;": '\U0000041B',
+ "LeftAngleBracket;": '\U000027E8',
+ "LeftArrow;": '\U00002190',
+ "LeftArrowBar;": '\U000021E4',
+ "LeftArrowRightArrow;": '\U000021C6',
+ "LeftCeiling;": '\U00002308',
+ "LeftDoubleBracket;": '\U000027E6',
+ "LeftDownTeeVector;": '\U00002961',
+ "LeftDownVector;": '\U000021C3',
+ "LeftDownVectorBar;": '\U00002959',
+ "LeftFloor;": '\U0000230A',
+ "LeftRightArrow;": '\U00002194',
+ "LeftRightVector;": '\U0000294E',
+ "LeftTee;": '\U000022A3',
+ "LeftTeeArrow;": '\U000021A4',
+ "LeftTeeVector;": '\U0000295A',
+ "LeftTriangle;": '\U000022B2',
+ "LeftTriangleBar;": '\U000029CF',
+ "LeftTriangleEqual;": '\U000022B4',
+ "LeftUpDownVector;": '\U00002951',
+ "LeftUpTeeVector;": '\U00002960',
+ "LeftUpVector;": '\U000021BF',
+ "LeftUpVectorBar;": '\U00002958',
+ "LeftVector;": '\U000021BC',
+ "LeftVectorBar;": '\U00002952',
+ "Leftarrow;": '\U000021D0',
+ "Leftrightarrow;": '\U000021D4',
+ "LessEqualGreater;": '\U000022DA',
+ "LessFullEqual;": '\U00002266',
+ "LessGreater;": '\U00002276',
+ "LessLess;": '\U00002AA1',
+ "LessSlantEqual;": '\U00002A7D',
+ "LessTilde;": '\U00002272',
+ "Lfr;": '\U0001D50F',
+ "Ll;": '\U000022D8',
+ "Lleftarrow;": '\U000021DA',
+ "Lmidot;": '\U0000013F',
+ "LongLeftArrow;": '\U000027F5',
+ "LongLeftRightArrow;": '\U000027F7',
+ "LongRightArrow;": '\U000027F6',
+ "Longleftarrow;": '\U000027F8',
+ "Longleftrightarrow;": '\U000027FA',
+ "Longrightarrow;": '\U000027F9',
+ "Lopf;": '\U0001D543',
+ "LowerLeftArrow;": '\U00002199',
+ "LowerRightArrow;": '\U00002198',
+ "Lscr;": '\U00002112',
+ "Lsh;": '\U000021B0',
+ "Lstrok;": '\U00000141',
+ "Lt;": '\U0000226A',
+ "Map;": '\U00002905',
+ "Mcy;": '\U0000041C',
+ "MediumSpace;": '\U0000205F',
+ "Mellintrf;": '\U00002133',
+ "Mfr;": '\U0001D510',
+ "MinusPlus;": '\U00002213',
+ "Mopf;": '\U0001D544',
+ "Mscr;": '\U00002133',
+ "Mu;": '\U0000039C',
+ "NJcy;": '\U0000040A',
+ "Nacute;": '\U00000143',
+ "Ncaron;": '\U00000147',
+ "Ncedil;": '\U00000145',
+ "Ncy;": '\U0000041D',
+ "NegativeMediumSpace;": '\U0000200B',
+ "NegativeThickSpace;": '\U0000200B',
+ "NegativeThinSpace;": '\U0000200B',
+ "NegativeVeryThinSpace;": '\U0000200B',
+ "NestedGreaterGreater;": '\U0000226B',
+ "NestedLessLess;": '\U0000226A',
+ "NewLine;": '\U0000000A',
+ "Nfr;": '\U0001D511',
+ "NoBreak;": '\U00002060',
+ "NonBreakingSpace;": '\U000000A0',
+ "Nopf;": '\U00002115',
+ "Not;": '\U00002AEC',
+ "NotCongruent;": '\U00002262',
+ "NotCupCap;": '\U0000226D',
+ "NotDoubleVerticalBar;": '\U00002226',
+ "NotElement;": '\U00002209',
+ "NotEqual;": '\U00002260',
+ "NotExists;": '\U00002204',
+ "NotGreater;": '\U0000226F',
+ "NotGreaterEqual;": '\U00002271',
+ "NotGreaterLess;": '\U00002279',
+ "NotGreaterTilde;": '\U00002275',
+ "NotLeftTriangle;": '\U000022EA',
+ "NotLeftTriangleEqual;": '\U000022EC',
+ "NotLess;": '\U0000226E',
+ "NotLessEqual;": '\U00002270',
+ "NotLessGreater;": '\U00002278',
+ "NotLessTilde;": '\U00002274',
+ "NotPrecedes;": '\U00002280',
+ "NotPrecedesSlantEqual;": '\U000022E0',
+ "NotReverseElement;": '\U0000220C',
+ "NotRightTriangle;": '\U000022EB',
+ "NotRightTriangleEqual;": '\U000022ED',
+ "NotSquareSubsetEqual;": '\U000022E2',
+ "NotSquareSupersetEqual;": '\U000022E3',
+ "NotSubsetEqual;": '\U00002288',
+ "NotSucceeds;": '\U00002281',
+ "NotSucceedsSlantEqual;": '\U000022E1',
+ "NotSupersetEqual;": '\U00002289',
+ "NotTilde;": '\U00002241',
+ "NotTildeEqual;": '\U00002244',
+ "NotTildeFullEqual;": '\U00002247',
+ "NotTildeTilde;": '\U00002249',
+ "NotVerticalBar;": '\U00002224',
+ "Nscr;": '\U0001D4A9',
+ "Ntilde;": '\U000000D1',
+ "Nu;": '\U0000039D',
+ "OElig;": '\U00000152',
+ "Oacute;": '\U000000D3',
+ "Ocirc;": '\U000000D4',
+ "Ocy;": '\U0000041E',
+ "Odblac;": '\U00000150',
+ "Ofr;": '\U0001D512',
+ "Ograve;": '\U000000D2',
+ "Omacr;": '\U0000014C',
+ "Omega;": '\U000003A9',
+ "Omicron;": '\U0000039F',
+ "Oopf;": '\U0001D546',
+ "OpenCurlyDoubleQuote;": '\U0000201C',
+ "OpenCurlyQuote;": '\U00002018',
+ "Or;": '\U00002A54',
+ "Oscr;": '\U0001D4AA',
+ "Oslash;": '\U000000D8',
+ "Otilde;": '\U000000D5',
+ "Otimes;": '\U00002A37',
+ "Ouml;": '\U000000D6',
+ "OverBar;": '\U0000203E',
+ "OverBrace;": '\U000023DE',
+ "OverBracket;": '\U000023B4',
+ "OverParenthesis;": '\U000023DC',
+ "PartialD;": '\U00002202',
+ "Pcy;": '\U0000041F',
+ "Pfr;": '\U0001D513',
+ "Phi;": '\U000003A6',
+ "Pi;": '\U000003A0',
+ "PlusMinus;": '\U000000B1',
+ "Poincareplane;": '\U0000210C',
+ "Popf;": '\U00002119',
+ "Pr;": '\U00002ABB',
+ "Precedes;": '\U0000227A',
+ "PrecedesEqual;": '\U00002AAF',
+ "PrecedesSlantEqual;": '\U0000227C',
+ "PrecedesTilde;": '\U0000227E',
+ "Prime;": '\U00002033',
+ "Product;": '\U0000220F',
+ "Proportion;": '\U00002237',
+ "Proportional;": '\U0000221D',
+ "Pscr;": '\U0001D4AB',
+ "Psi;": '\U000003A8',
+ "QUOT;": '\U00000022',
+ "Qfr;": '\U0001D514',
+ "Qopf;": '\U0000211A',
+ "Qscr;": '\U0001D4AC',
+ "RBarr;": '\U00002910',
+ "REG;": '\U000000AE',
+ "Racute;": '\U00000154',
+ "Rang;": '\U000027EB',
+ "Rarr;": '\U000021A0',
+ "Rarrtl;": '\U00002916',
+ "Rcaron;": '\U00000158',
+ "Rcedil;": '\U00000156',
+ "Rcy;": '\U00000420',
+ "Re;": '\U0000211C',
+ "ReverseElement;": '\U0000220B',
+ "ReverseEquilibrium;": '\U000021CB',
+ "ReverseUpEquilibrium;": '\U0000296F',
+ "Rfr;": '\U0000211C',
+ "Rho;": '\U000003A1',
+ "RightAngleBracket;": '\U000027E9',
+ "RightArrow;": '\U00002192',
+ "RightArrowBar;": '\U000021E5',
+ "RightArrowLeftArrow;": '\U000021C4',
+ "RightCeiling;": '\U00002309',
+ "RightDoubleBracket;": '\U000027E7',
+ "RightDownTeeVector;": '\U0000295D',
+ "RightDownVector;": '\U000021C2',
+ "RightDownVectorBar;": '\U00002955',
+ "RightFloor;": '\U0000230B',
+ "RightTee;": '\U000022A2',
+ "RightTeeArrow;": '\U000021A6',
+ "RightTeeVector;": '\U0000295B',
+ "RightTriangle;": '\U000022B3',
+ "RightTriangleBar;": '\U000029D0',
+ "RightTriangleEqual;": '\U000022B5',
+ "RightUpDownVector;": '\U0000294F',
+ "RightUpTeeVector;": '\U0000295C',
+ "RightUpVector;": '\U000021BE',
+ "RightUpVectorBar;": '\U00002954',
+ "RightVector;": '\U000021C0',
+ "RightVectorBar;": '\U00002953',
+ "Rightarrow;": '\U000021D2',
+ "Ropf;": '\U0000211D',
+ "RoundImplies;": '\U00002970',
+ "Rrightarrow;": '\U000021DB',
+ "Rscr;": '\U0000211B',
+ "Rsh;": '\U000021B1',
+ "RuleDelayed;": '\U000029F4',
+ "SHCHcy;": '\U00000429',
+ "SHcy;": '\U00000428',
+ "SOFTcy;": '\U0000042C',
+ "Sacute;": '\U0000015A',
+ "Sc;": '\U00002ABC',
+ "Scaron;": '\U00000160',
+ "Scedil;": '\U0000015E',
+ "Scirc;": '\U0000015C',
+ "Scy;": '\U00000421',
+ "Sfr;": '\U0001D516',
+ "ShortDownArrow;": '\U00002193',
+ "ShortLeftArrow;": '\U00002190',
+ "ShortRightArrow;": '\U00002192',
+ "ShortUpArrow;": '\U00002191',
+ "Sigma;": '\U000003A3',
+ "SmallCircle;": '\U00002218',
+ "Sopf;": '\U0001D54A',
+ "Sqrt;": '\U0000221A',
+ "Square;": '\U000025A1',
+ "SquareIntersection;": '\U00002293',
+ "SquareSubset;": '\U0000228F',
+ "SquareSubsetEqual;": '\U00002291',
+ "SquareSuperset;": '\U00002290',
+ "SquareSupersetEqual;": '\U00002292',
+ "SquareUnion;": '\U00002294',
+ "Sscr;": '\U0001D4AE',
+ "Star;": '\U000022C6',
+ "Sub;": '\U000022D0',
+ "Subset;": '\U000022D0',
+ "SubsetEqual;": '\U00002286',
+ "Succeeds;": '\U0000227B',
+ "SucceedsEqual;": '\U00002AB0',
+ "SucceedsSlantEqual;": '\U0000227D',
+ "SucceedsTilde;": '\U0000227F',
+ "SuchThat;": '\U0000220B',
+ "Sum;": '\U00002211',
+ "Sup;": '\U000022D1',
+ "Superset;": '\U00002283',
+ "SupersetEqual;": '\U00002287',
+ "Supset;": '\U000022D1',
+ "THORN;": '\U000000DE',
+ "TRADE;": '\U00002122',
+ "TSHcy;": '\U0000040B',
+ "TScy;": '\U00000426',
+ "Tab;": '\U00000009',
+ "Tau;": '\U000003A4',
+ "Tcaron;": '\U00000164',
+ "Tcedil;": '\U00000162',
+ "Tcy;": '\U00000422',
+ "Tfr;": '\U0001D517',
+ "Therefore;": '\U00002234',
+ "Theta;": '\U00000398',
+ "ThinSpace;": '\U00002009',
+ "Tilde;": '\U0000223C',
+ "TildeEqual;": '\U00002243',
+ "TildeFullEqual;": '\U00002245',
+ "TildeTilde;": '\U00002248',
+ "Topf;": '\U0001D54B',
+ "TripleDot;": '\U000020DB',
+ "Tscr;": '\U0001D4AF',
+ "Tstrok;": '\U00000166',
+ "Uacute;": '\U000000DA',
+ "Uarr;": '\U0000219F',
+ "Uarrocir;": '\U00002949',
+ "Ubrcy;": '\U0000040E',
+ "Ubreve;": '\U0000016C',
+ "Ucirc;": '\U000000DB',
+ "Ucy;": '\U00000423',
+ "Udblac;": '\U00000170',
+ "Ufr;": '\U0001D518',
+ "Ugrave;": '\U000000D9',
+ "Umacr;": '\U0000016A',
+ "UnderBar;": '\U0000005F',
+ "UnderBrace;": '\U000023DF',
+ "UnderBracket;": '\U000023B5',
+ "UnderParenthesis;": '\U000023DD',
+ "Union;": '\U000022C3',
+ "UnionPlus;": '\U0000228E',
+ "Uogon;": '\U00000172',
+ "Uopf;": '\U0001D54C',
+ "UpArrow;": '\U00002191',
+ "UpArrowBar;": '\U00002912',
+ "UpArrowDownArrow;": '\U000021C5',
+ "UpDownArrow;": '\U00002195',
+ "UpEquilibrium;": '\U0000296E',
+ "UpTee;": '\U000022A5',
+ "UpTeeArrow;": '\U000021A5',
+ "Uparrow;": '\U000021D1',
+ "Updownarrow;": '\U000021D5',
+ "UpperLeftArrow;": '\U00002196',
+ "UpperRightArrow;": '\U00002197',
+ "Upsi;": '\U000003D2',
+ "Upsilon;": '\U000003A5',
+ "Uring;": '\U0000016E',
+ "Uscr;": '\U0001D4B0',
+ "Utilde;": '\U00000168',
+ "Uuml;": '\U000000DC',
+ "VDash;": '\U000022AB',
+ "Vbar;": '\U00002AEB',
+ "Vcy;": '\U00000412',
+ "Vdash;": '\U000022A9',
+ "Vdashl;": '\U00002AE6',
+ "Vee;": '\U000022C1',
+ "Verbar;": '\U00002016',
+ "Vert;": '\U00002016',
+ "VerticalBar;": '\U00002223',
+ "VerticalLine;": '\U0000007C',
+ "VerticalSeparator;": '\U00002758',
+ "VerticalTilde;": '\U00002240',
+ "VeryThinSpace;": '\U0000200A',
+ "Vfr;": '\U0001D519',
+ "Vopf;": '\U0001D54D',
+ "Vscr;": '\U0001D4B1',
+ "Vvdash;": '\U000022AA',
+ "Wcirc;": '\U00000174',
+ "Wedge;": '\U000022C0',
+ "Wfr;": '\U0001D51A',
+ "Wopf;": '\U0001D54E',
+ "Wscr;": '\U0001D4B2',
+ "Xfr;": '\U0001D51B',
+ "Xi;": '\U0000039E',
+ "Xopf;": '\U0001D54F',
+ "Xscr;": '\U0001D4B3',
+ "YAcy;": '\U0000042F',
+ "YIcy;": '\U00000407',
+ "YUcy;": '\U0000042E',
+ "Yacute;": '\U000000DD',
+ "Ycirc;": '\U00000176',
+ "Ycy;": '\U0000042B',
+ "Yfr;": '\U0001D51C',
+ "Yopf;": '\U0001D550',
+ "Yscr;": '\U0001D4B4',
+ "Yuml;": '\U00000178',
+ "ZHcy;": '\U00000416',
+ "Zacute;": '\U00000179',
+ "Zcaron;": '\U0000017D',
+ "Zcy;": '\U00000417',
+ "Zdot;": '\U0000017B',
+ "ZeroWidthSpace;": '\U0000200B',
+ "Zeta;": '\U00000396',
+ "Zfr;": '\U00002128',
+ "Zopf;": '\U00002124',
+ "Zscr;": '\U0001D4B5',
+ "aacute;": '\U000000E1',
+ "abreve;": '\U00000103',
+ "ac;": '\U0000223E',
+ "acd;": '\U0000223F',
+ "acirc;": '\U000000E2',
+ "acute;": '\U000000B4',
+ "acy;": '\U00000430',
+ "aelig;": '\U000000E6',
+ "af;": '\U00002061',
+ "afr;": '\U0001D51E',
+ "agrave;": '\U000000E0',
+ "alefsym;": '\U00002135',
+ "aleph;": '\U00002135',
+ "alpha;": '\U000003B1',
+ "amacr;": '\U00000101',
+ "amalg;": '\U00002A3F',
+ "amp;": '\U00000026',
+ "and;": '\U00002227',
+ "andand;": '\U00002A55',
+ "andd;": '\U00002A5C',
+ "andslope;": '\U00002A58',
+ "andv;": '\U00002A5A',
+ "ang;": '\U00002220',
+ "ange;": '\U000029A4',
+ "angle;": '\U00002220',
+ "angmsd;": '\U00002221',
+ "angmsdaa;": '\U000029A8',
+ "angmsdab;": '\U000029A9',
+ "angmsdac;": '\U000029AA',
+ "angmsdad;": '\U000029AB',
+ "angmsdae;": '\U000029AC',
+ "angmsdaf;": '\U000029AD',
+ "angmsdag;": '\U000029AE',
+ "angmsdah;": '\U000029AF',
+ "angrt;": '\U0000221F',
+ "angrtvb;": '\U000022BE',
+ "angrtvbd;": '\U0000299D',
+ "angsph;": '\U00002222',
+ "angst;": '\U000000C5',
+ "angzarr;": '\U0000237C',
+ "aogon;": '\U00000105',
+ "aopf;": '\U0001D552',
+ "ap;": '\U00002248',
+ "apE;": '\U00002A70',
+ "apacir;": '\U00002A6F',
+ "ape;": '\U0000224A',
+ "apid;": '\U0000224B',
+ "apos;": '\U00000027',
+ "approx;": '\U00002248',
+ "approxeq;": '\U0000224A',
+ "aring;": '\U000000E5',
+ "ascr;": '\U0001D4B6',
+ "ast;": '\U0000002A',
+ "asymp;": '\U00002248',
+ "asympeq;": '\U0000224D',
+ "atilde;": '\U000000E3',
+ "auml;": '\U000000E4',
+ "awconint;": '\U00002233',
+ "awint;": '\U00002A11',
+ "bNot;": '\U00002AED',
+ "backcong;": '\U0000224C',
+ "backepsilon;": '\U000003F6',
+ "backprime;": '\U00002035',
+ "backsim;": '\U0000223D',
+ "backsimeq;": '\U000022CD',
+ "barvee;": '\U000022BD',
+ "barwed;": '\U00002305',
+ "barwedge;": '\U00002305',
+ "bbrk;": '\U000023B5',
+ "bbrktbrk;": '\U000023B6',
+ "bcong;": '\U0000224C',
+ "bcy;": '\U00000431',
+ "bdquo;": '\U0000201E',
+ "becaus;": '\U00002235',
+ "because;": '\U00002235',
+ "bemptyv;": '\U000029B0',
+ "bepsi;": '\U000003F6',
+ "bernou;": '\U0000212C',
+ "beta;": '\U000003B2',
+ "beth;": '\U00002136',
+ "between;": '\U0000226C',
+ "bfr;": '\U0001D51F',
+ "bigcap;": '\U000022C2',
+ "bigcirc;": '\U000025EF',
+ "bigcup;": '\U000022C3',
+ "bigodot;": '\U00002A00',
+ "bigoplus;": '\U00002A01',
+ "bigotimes;": '\U00002A02',
+ "bigsqcup;": '\U00002A06',
+ "bigstar;": '\U00002605',
+ "bigtriangledown;": '\U000025BD',
+ "bigtriangleup;": '\U000025B3',
+ "biguplus;": '\U00002A04',
+ "bigvee;": '\U000022C1',
+ "bigwedge;": '\U000022C0',
+ "bkarow;": '\U0000290D',
+ "blacklozenge;": '\U000029EB',
+ "blacksquare;": '\U000025AA',
+ "blacktriangle;": '\U000025B4',
+ "blacktriangledown;": '\U000025BE',
+ "blacktriangleleft;": '\U000025C2',
+ "blacktriangleright;": '\U000025B8',
+ "blank;": '\U00002423',
+ "blk12;": '\U00002592',
+ "blk14;": '\U00002591',
+ "blk34;": '\U00002593',
+ "block;": '\U00002588',
+ "bnot;": '\U00002310',
+ "bopf;": '\U0001D553',
+ "bot;": '\U000022A5',
+ "bottom;": '\U000022A5',
+ "bowtie;": '\U000022C8',
+ "boxDL;": '\U00002557',
+ "boxDR;": '\U00002554',
+ "boxDl;": '\U00002556',
+ "boxDr;": '\U00002553',
+ "boxH;": '\U00002550',
+ "boxHD;": '\U00002566',
+ "boxHU;": '\U00002569',
+ "boxHd;": '\U00002564',
+ "boxHu;": '\U00002567',
+ "boxUL;": '\U0000255D',
+ "boxUR;": '\U0000255A',
+ "boxUl;": '\U0000255C',
+ "boxUr;": '\U00002559',
+ "boxV;": '\U00002551',
+ "boxVH;": '\U0000256C',
+ "boxVL;": '\U00002563',
+ "boxVR;": '\U00002560',
+ "boxVh;": '\U0000256B',
+ "boxVl;": '\U00002562',
+ "boxVr;": '\U0000255F',
+ "boxbox;": '\U000029C9',
+ "boxdL;": '\U00002555',
+ "boxdR;": '\U00002552',
+ "boxdl;": '\U00002510',
+ "boxdr;": '\U0000250C',
+ "boxh;": '\U00002500',
+ "boxhD;": '\U00002565',
+ "boxhU;": '\U00002568',
+ "boxhd;": '\U0000252C',
+ "boxhu;": '\U00002534',
+ "boxminus;": '\U0000229F',
+ "boxplus;": '\U0000229E',
+ "boxtimes;": '\U000022A0',
+ "boxuL;": '\U0000255B',
+ "boxuR;": '\U00002558',
+ "boxul;": '\U00002518',
+ "boxur;": '\U00002514',
+ "boxv;": '\U00002502',
+ "boxvH;": '\U0000256A',
+ "boxvL;": '\U00002561',
+ "boxvR;": '\U0000255E',
+ "boxvh;": '\U0000253C',
+ "boxvl;": '\U00002524',
+ "boxvr;": '\U0000251C',
+ "bprime;": '\U00002035',
+ "breve;": '\U000002D8',
+ "brvbar;": '\U000000A6',
+ "bscr;": '\U0001D4B7',
+ "bsemi;": '\U0000204F',
+ "bsim;": '\U0000223D',
+ "bsime;": '\U000022CD',
+ "bsol;": '\U0000005C',
+ "bsolb;": '\U000029C5',
+ "bsolhsub;": '\U000027C8',
+ "bull;": '\U00002022',
+ "bullet;": '\U00002022',
+ "bump;": '\U0000224E',
+ "bumpE;": '\U00002AAE',
+ "bumpe;": '\U0000224F',
+ "bumpeq;": '\U0000224F',
+ "cacute;": '\U00000107',
+ "cap;": '\U00002229',
+ "capand;": '\U00002A44',
+ "capbrcup;": '\U00002A49',
+ "capcap;": '\U00002A4B',
+ "capcup;": '\U00002A47',
+ "capdot;": '\U00002A40',
+ "caret;": '\U00002041',
+ "caron;": '\U000002C7',
+ "ccaps;": '\U00002A4D',
+ "ccaron;": '\U0000010D',
+ "ccedil;": '\U000000E7',
+ "ccirc;": '\U00000109',
+ "ccups;": '\U00002A4C',
+ "ccupssm;": '\U00002A50',
+ "cdot;": '\U0000010B',
+ "cedil;": '\U000000B8',
+ "cemptyv;": '\U000029B2',
+ "cent;": '\U000000A2',
+ "centerdot;": '\U000000B7',
+ "cfr;": '\U0001D520',
+ "chcy;": '\U00000447',
+ "check;": '\U00002713',
+ "checkmark;": '\U00002713',
+ "chi;": '\U000003C7',
+ "cir;": '\U000025CB',
+ "cirE;": '\U000029C3',
+ "circ;": '\U000002C6',
+ "circeq;": '\U00002257',
+ "circlearrowleft;": '\U000021BA',
+ "circlearrowright;": '\U000021BB',
+ "circledR;": '\U000000AE',
+ "circledS;": '\U000024C8',
+ "circledast;": '\U0000229B',
+ "circledcirc;": '\U0000229A',
+ "circleddash;": '\U0000229D',
+ "cire;": '\U00002257',
+ "cirfnint;": '\U00002A10',
+ "cirmid;": '\U00002AEF',
+ "cirscir;": '\U000029C2',
+ "clubs;": '\U00002663',
+ "clubsuit;": '\U00002663',
+ "colon;": '\U0000003A',
+ "colone;": '\U00002254',
+ "coloneq;": '\U00002254',
+ "comma;": '\U0000002C',
+ "commat;": '\U00000040',
+ "comp;": '\U00002201',
+ "compfn;": '\U00002218',
+ "complement;": '\U00002201',
+ "complexes;": '\U00002102',
+ "cong;": '\U00002245',
+ "congdot;": '\U00002A6D',
+ "conint;": '\U0000222E',
+ "copf;": '\U0001D554',
+ "coprod;": '\U00002210',
+ "copy;": '\U000000A9',
+ "copysr;": '\U00002117',
+ "crarr;": '\U000021B5',
+ "cross;": '\U00002717',
+ "cscr;": '\U0001D4B8',
+ "csub;": '\U00002ACF',
+ "csube;": '\U00002AD1',
+ "csup;": '\U00002AD0',
+ "csupe;": '\U00002AD2',
+ "ctdot;": '\U000022EF',
+ "cudarrl;": '\U00002938',
+ "cudarrr;": '\U00002935',
+ "cuepr;": '\U000022DE',
+ "cuesc;": '\U000022DF',
+ "cularr;": '\U000021B6',
+ "cularrp;": '\U0000293D',
+ "cup;": '\U0000222A',
+ "cupbrcap;": '\U00002A48',
+ "cupcap;": '\U00002A46',
+ "cupcup;": '\U00002A4A',
+ "cupdot;": '\U0000228D',
+ "cupor;": '\U00002A45',
+ "curarr;": '\U000021B7',
+ "curarrm;": '\U0000293C',
+ "curlyeqprec;": '\U000022DE',
+ "curlyeqsucc;": '\U000022DF',
+ "curlyvee;": '\U000022CE',
+ "curlywedge;": '\U000022CF',
+ "curren;": '\U000000A4',
+ "curvearrowleft;": '\U000021B6',
+ "curvearrowright;": '\U000021B7',
+ "cuvee;": '\U000022CE',
+ "cuwed;": '\U000022CF',
+ "cwconint;": '\U00002232',
+ "cwint;": '\U00002231',
+ "cylcty;": '\U0000232D',
+ "dArr;": '\U000021D3',
+ "dHar;": '\U00002965',
+ "dagger;": '\U00002020',
+ "daleth;": '\U00002138',
+ "darr;": '\U00002193',
+ "dash;": '\U00002010',
+ "dashv;": '\U000022A3',
+ "dbkarow;": '\U0000290F',
+ "dblac;": '\U000002DD',
+ "dcaron;": '\U0000010F',
+ "dcy;": '\U00000434',
+ "dd;": '\U00002146',
+ "ddagger;": '\U00002021',
+ "ddarr;": '\U000021CA',
+ "ddotseq;": '\U00002A77',
+ "deg;": '\U000000B0',
+ "delta;": '\U000003B4',
+ "demptyv;": '\U000029B1',
+ "dfisht;": '\U0000297F',
+ "dfr;": '\U0001D521',
+ "dharl;": '\U000021C3',
+ "dharr;": '\U000021C2',
+ "diam;": '\U000022C4',
+ "diamond;": '\U000022C4',
+ "diamondsuit;": '\U00002666',
+ "diams;": '\U00002666',
+ "die;": '\U000000A8',
+ "digamma;": '\U000003DD',
+ "disin;": '\U000022F2',
+ "div;": '\U000000F7',
+ "divide;": '\U000000F7',
+ "divideontimes;": '\U000022C7',
+ "divonx;": '\U000022C7',
+ "djcy;": '\U00000452',
+ "dlcorn;": '\U0000231E',
+ "dlcrop;": '\U0000230D',
+ "dollar;": '\U00000024',
+ "dopf;": '\U0001D555',
+ "dot;": '\U000002D9',
+ "doteq;": '\U00002250',
+ "doteqdot;": '\U00002251',
+ "dotminus;": '\U00002238',
+ "dotplus;": '\U00002214',
+ "dotsquare;": '\U000022A1',
+ "doublebarwedge;": '\U00002306',
+ "downarrow;": '\U00002193',
+ "downdownarrows;": '\U000021CA',
+ "downharpoonleft;": '\U000021C3',
+ "downharpoonright;": '\U000021C2',
+ "drbkarow;": '\U00002910',
+ "drcorn;": '\U0000231F',
+ "drcrop;": '\U0000230C',
+ "dscr;": '\U0001D4B9',
+ "dscy;": '\U00000455',
+ "dsol;": '\U000029F6',
+ "dstrok;": '\U00000111',
+ "dtdot;": '\U000022F1',
+ "dtri;": '\U000025BF',
+ "dtrif;": '\U000025BE',
+ "duarr;": '\U000021F5',
+ "duhar;": '\U0000296F',
+ "dwangle;": '\U000029A6',
+ "dzcy;": '\U0000045F',
+ "dzigrarr;": '\U000027FF',
+ "eDDot;": '\U00002A77',
+ "eDot;": '\U00002251',
+ "eacute;": '\U000000E9',
+ "easter;": '\U00002A6E',
+ "ecaron;": '\U0000011B',
+ "ecir;": '\U00002256',
+ "ecirc;": '\U000000EA',
+ "ecolon;": '\U00002255',
+ "ecy;": '\U0000044D',
+ "edot;": '\U00000117',
+ "ee;": '\U00002147',
+ "efDot;": '\U00002252',
+ "efr;": '\U0001D522',
+ "eg;": '\U00002A9A',
+ "egrave;": '\U000000E8',
+ "egs;": '\U00002A96',
+ "egsdot;": '\U00002A98',
+ "el;": '\U00002A99',
+ "elinters;": '\U000023E7',
+ "ell;": '\U00002113',
+ "els;": '\U00002A95',
+ "elsdot;": '\U00002A97',
+ "emacr;": '\U00000113',
+ "empty;": '\U00002205',
+ "emptyset;": '\U00002205',
+ "emptyv;": '\U00002205',
+ "emsp;": '\U00002003',
+ "emsp13;": '\U00002004',
+ "emsp14;": '\U00002005',
+ "eng;": '\U0000014B',
+ "ensp;": '\U00002002',
+ "eogon;": '\U00000119',
+ "eopf;": '\U0001D556',
+ "epar;": '\U000022D5',
+ "eparsl;": '\U000029E3',
+ "eplus;": '\U00002A71',
+ "epsi;": '\U000003B5',
+ "epsilon;": '\U000003B5',
+ "epsiv;": '\U000003F5',
+ "eqcirc;": '\U00002256',
+ "eqcolon;": '\U00002255',
+ "eqsim;": '\U00002242',
+ "eqslantgtr;": '\U00002A96',
+ "eqslantless;": '\U00002A95',
+ "equals;": '\U0000003D',
+ "equest;": '\U0000225F',
+ "equiv;": '\U00002261',
+ "equivDD;": '\U00002A78',
+ "eqvparsl;": '\U000029E5',
+ "erDot;": '\U00002253',
+ "erarr;": '\U00002971',
+ "escr;": '\U0000212F',
+ "esdot;": '\U00002250',
+ "esim;": '\U00002242',
+ "eta;": '\U000003B7',
+ "eth;": '\U000000F0',
+ "euml;": '\U000000EB',
+ "euro;": '\U000020AC',
+ "excl;": '\U00000021',
+ "exist;": '\U00002203',
+ "expectation;": '\U00002130',
+ "exponentiale;": '\U00002147',
+ "fallingdotseq;": '\U00002252',
+ "fcy;": '\U00000444',
+ "female;": '\U00002640',
+ "ffilig;": '\U0000FB03',
+ "fflig;": '\U0000FB00',
+ "ffllig;": '\U0000FB04',
+ "ffr;": '\U0001D523',
+ "filig;": '\U0000FB01',
+ "flat;": '\U0000266D',
+ "fllig;": '\U0000FB02',
+ "fltns;": '\U000025B1',
+ "fnof;": '\U00000192',
+ "fopf;": '\U0001D557',
+ "forall;": '\U00002200',
+ "fork;": '\U000022D4',
+ "forkv;": '\U00002AD9',
+ "fpartint;": '\U00002A0D',
+ "frac12;": '\U000000BD',
+ "frac13;": '\U00002153',
+ "frac14;": '\U000000BC',
+ "frac15;": '\U00002155',
+ "frac16;": '\U00002159',
+ "frac18;": '\U0000215B',
+ "frac23;": '\U00002154',
+ "frac25;": '\U00002156',
+ "frac34;": '\U000000BE',
+ "frac35;": '\U00002157',
+ "frac38;": '\U0000215C',
+ "frac45;": '\U00002158',
+ "frac56;": '\U0000215A',
+ "frac58;": '\U0000215D',
+ "frac78;": '\U0000215E',
+ "frasl;": '\U00002044',
+ "frown;": '\U00002322',
+ "fscr;": '\U0001D4BB',
+ "gE;": '\U00002267',
+ "gEl;": '\U00002A8C',
+ "gacute;": '\U000001F5',
+ "gamma;": '\U000003B3',
+ "gammad;": '\U000003DD',
+ "gap;": '\U00002A86',
+ "gbreve;": '\U0000011F',
+ "gcirc;": '\U0000011D',
+ "gcy;": '\U00000433',
+ "gdot;": '\U00000121',
+ "ge;": '\U00002265',
+ "gel;": '\U000022DB',
+ "geq;": '\U00002265',
+ "geqq;": '\U00002267',
+ "geqslant;": '\U00002A7E',
+ "ges;": '\U00002A7E',
+ "gescc;": '\U00002AA9',
+ "gesdot;": '\U00002A80',
+ "gesdoto;": '\U00002A82',
+ "gesdotol;": '\U00002A84',
+ "gesles;": '\U00002A94',
+ "gfr;": '\U0001D524',
+ "gg;": '\U0000226B',
+ "ggg;": '\U000022D9',
+ "gimel;": '\U00002137',
+ "gjcy;": '\U00000453',
+ "gl;": '\U00002277',
+ "glE;": '\U00002A92',
+ "gla;": '\U00002AA5',
+ "glj;": '\U00002AA4',
+ "gnE;": '\U00002269',
+ "gnap;": '\U00002A8A',
+ "gnapprox;": '\U00002A8A',
+ "gne;": '\U00002A88',
+ "gneq;": '\U00002A88',
+ "gneqq;": '\U00002269',
+ "gnsim;": '\U000022E7',
+ "gopf;": '\U0001D558',
+ "grave;": '\U00000060',
+ "gscr;": '\U0000210A',
+ "gsim;": '\U00002273',
+ "gsime;": '\U00002A8E',
+ "gsiml;": '\U00002A90',
+ "gt;": '\U0000003E',
+ "gtcc;": '\U00002AA7',
+ "gtcir;": '\U00002A7A',
+ "gtdot;": '\U000022D7',
+ "gtlPar;": '\U00002995',
+ "gtquest;": '\U00002A7C',
+ "gtrapprox;": '\U00002A86',
+ "gtrarr;": '\U00002978',
+ "gtrdot;": '\U000022D7',
+ "gtreqless;": '\U000022DB',
+ "gtreqqless;": '\U00002A8C',
+ "gtrless;": '\U00002277',
+ "gtrsim;": '\U00002273',
+ "hArr;": '\U000021D4',
+ "hairsp;": '\U0000200A',
+ "half;": '\U000000BD',
+ "hamilt;": '\U0000210B',
+ "hardcy;": '\U0000044A',
+ "harr;": '\U00002194',
+ "harrcir;": '\U00002948',
+ "harrw;": '\U000021AD',
+ "hbar;": '\U0000210F',
+ "hcirc;": '\U00000125',
+ "hearts;": '\U00002665',
+ "heartsuit;": '\U00002665',
+ "hellip;": '\U00002026',
+ "hercon;": '\U000022B9',
+ "hfr;": '\U0001D525',
+ "hksearow;": '\U00002925',
+ "hkswarow;": '\U00002926',
+ "hoarr;": '\U000021FF',
+ "homtht;": '\U0000223B',
+ "hookleftarrow;": '\U000021A9',
+ "hookrightarrow;": '\U000021AA',
+ "hopf;": '\U0001D559',
+ "horbar;": '\U00002015',
+ "hscr;": '\U0001D4BD',
+ "hslash;": '\U0000210F',
+ "hstrok;": '\U00000127',
+ "hybull;": '\U00002043',
+ "hyphen;": '\U00002010',
+ "iacute;": '\U000000ED',
+ "ic;": '\U00002063',
+ "icirc;": '\U000000EE',
+ "icy;": '\U00000438',
+ "iecy;": '\U00000435',
+ "iexcl;": '\U000000A1',
+ "iff;": '\U000021D4',
+ "ifr;": '\U0001D526',
+ "igrave;": '\U000000EC',
+ "ii;": '\U00002148',
+ "iiiint;": '\U00002A0C',
+ "iiint;": '\U0000222D',
+ "iinfin;": '\U000029DC',
+ "iiota;": '\U00002129',
+ "ijlig;": '\U00000133',
+ "imacr;": '\U0000012B',
+ "image;": '\U00002111',
+ "imagline;": '\U00002110',
+ "imagpart;": '\U00002111',
+ "imath;": '\U00000131',
+ "imof;": '\U000022B7',
+ "imped;": '\U000001B5',
+ "in;": '\U00002208',
+ "incare;": '\U00002105',
+ "infin;": '\U0000221E',
+ "infintie;": '\U000029DD',
+ "inodot;": '\U00000131',
+ "int;": '\U0000222B',
+ "intcal;": '\U000022BA',
+ "integers;": '\U00002124',
+ "intercal;": '\U000022BA',
+ "intlarhk;": '\U00002A17',
+ "intprod;": '\U00002A3C',
+ "iocy;": '\U00000451',
+ "iogon;": '\U0000012F',
+ "iopf;": '\U0001D55A',
+ "iota;": '\U000003B9',
+ "iprod;": '\U00002A3C',
+ "iquest;": '\U000000BF',
+ "iscr;": '\U0001D4BE',
+ "isin;": '\U00002208',
+ "isinE;": '\U000022F9',
+ "isindot;": '\U000022F5',
+ "isins;": '\U000022F4',
+ "isinsv;": '\U000022F3',
+ "isinv;": '\U00002208',
+ "it;": '\U00002062',
+ "itilde;": '\U00000129',
+ "iukcy;": '\U00000456',
+ "iuml;": '\U000000EF',
+ "jcirc;": '\U00000135',
+ "jcy;": '\U00000439',
+ "jfr;": '\U0001D527',
+ "jmath;": '\U00000237',
+ "jopf;": '\U0001D55B',
+ "jscr;": '\U0001D4BF',
+ "jsercy;": '\U00000458',
+ "jukcy;": '\U00000454',
+ "kappa;": '\U000003BA',
+ "kappav;": '\U000003F0',
+ "kcedil;": '\U00000137',
+ "kcy;": '\U0000043A',
+ "kfr;": '\U0001D528',
+ "kgreen;": '\U00000138',
+ "khcy;": '\U00000445',
+ "kjcy;": '\U0000045C',
+ "kopf;": '\U0001D55C',
+ "kscr;": '\U0001D4C0',
+ "lAarr;": '\U000021DA',
+ "lArr;": '\U000021D0',
+ "lAtail;": '\U0000291B',
+ "lBarr;": '\U0000290E',
+ "lE;": '\U00002266',
+ "lEg;": '\U00002A8B',
+ "lHar;": '\U00002962',
+ "lacute;": '\U0000013A',
+ "laemptyv;": '\U000029B4',
+ "lagran;": '\U00002112',
+ "lambda;": '\U000003BB',
+ "lang;": '\U000027E8',
+ "langd;": '\U00002991',
+ "langle;": '\U000027E8',
+ "lap;": '\U00002A85',
+ "laquo;": '\U000000AB',
+ "larr;": '\U00002190',
+ "larrb;": '\U000021E4',
+ "larrbfs;": '\U0000291F',
+ "larrfs;": '\U0000291D',
+ "larrhk;": '\U000021A9',
+ "larrlp;": '\U000021AB',
+ "larrpl;": '\U00002939',
+ "larrsim;": '\U00002973',
+ "larrtl;": '\U000021A2',
+ "lat;": '\U00002AAB',
+ "latail;": '\U00002919',
+ "late;": '\U00002AAD',
+ "lbarr;": '\U0000290C',
+ "lbbrk;": '\U00002772',
+ "lbrace;": '\U0000007B',
+ "lbrack;": '\U0000005B',
+ "lbrke;": '\U0000298B',
+ "lbrksld;": '\U0000298F',
+ "lbrkslu;": '\U0000298D',
+ "lcaron;": '\U0000013E',
+ "lcedil;": '\U0000013C',
+ "lceil;": '\U00002308',
+ "lcub;": '\U0000007B',
+ "lcy;": '\U0000043B',
+ "ldca;": '\U00002936',
+ "ldquo;": '\U0000201C',
+ "ldquor;": '\U0000201E',
+ "ldrdhar;": '\U00002967',
+ "ldrushar;": '\U0000294B',
+ "ldsh;": '\U000021B2',
+ "le;": '\U00002264',
+ "leftarrow;": '\U00002190',
+ "leftarrowtail;": '\U000021A2',
+ "leftharpoondown;": '\U000021BD',
+ "leftharpoonup;": '\U000021BC',
+ "leftleftarrows;": '\U000021C7',
+ "leftrightarrow;": '\U00002194',
+ "leftrightarrows;": '\U000021C6',
+ "leftrightharpoons;": '\U000021CB',
+ "leftrightsquigarrow;": '\U000021AD',
+ "leftthreetimes;": '\U000022CB',
+ "leg;": '\U000022DA',
+ "leq;": '\U00002264',
+ "leqq;": '\U00002266',
+ "leqslant;": '\U00002A7D',
+ "les;": '\U00002A7D',
+ "lescc;": '\U00002AA8',
+ "lesdot;": '\U00002A7F',
+ "lesdoto;": '\U00002A81',
+ "lesdotor;": '\U00002A83',
+ "lesges;": '\U00002A93',
+ "lessapprox;": '\U00002A85',
+ "lessdot;": '\U000022D6',
+ "lesseqgtr;": '\U000022DA',
+ "lesseqqgtr;": '\U00002A8B',
+ "lessgtr;": '\U00002276',
+ "lesssim;": '\U00002272',
+ "lfisht;": '\U0000297C',
+ "lfloor;": '\U0000230A',
+ "lfr;": '\U0001D529',
+ "lg;": '\U00002276',
+ "lgE;": '\U00002A91',
+ "lhard;": '\U000021BD',
+ "lharu;": '\U000021BC',
+ "lharul;": '\U0000296A',
+ "lhblk;": '\U00002584',
+ "ljcy;": '\U00000459',
+ "ll;": '\U0000226A',
+ "llarr;": '\U000021C7',
+ "llcorner;": '\U0000231E',
+ "llhard;": '\U0000296B',
+ "lltri;": '\U000025FA',
+ "lmidot;": '\U00000140',
+ "lmoust;": '\U000023B0',
+ "lmoustache;": '\U000023B0',
+ "lnE;": '\U00002268',
+ "lnap;": '\U00002A89',
+ "lnapprox;": '\U00002A89',
+ "lne;": '\U00002A87',
+ "lneq;": '\U00002A87',
+ "lneqq;": '\U00002268',
+ "lnsim;": '\U000022E6',
+ "loang;": '\U000027EC',
+ "loarr;": '\U000021FD',
+ "lobrk;": '\U000027E6',
+ "longleftarrow;": '\U000027F5',
+ "longleftrightarrow;": '\U000027F7',
+ "longmapsto;": '\U000027FC',
+ "longrightarrow;": '\U000027F6',
+ "looparrowleft;": '\U000021AB',
+ "looparrowright;": '\U000021AC',
+ "lopar;": '\U00002985',
+ "lopf;": '\U0001D55D',
+ "loplus;": '\U00002A2D',
+ "lotimes;": '\U00002A34',
+ "lowast;": '\U00002217',
+ "lowbar;": '\U0000005F',
+ "loz;": '\U000025CA',
+ "lozenge;": '\U000025CA',
+ "lozf;": '\U000029EB',
+ "lpar;": '\U00000028',
+ "lparlt;": '\U00002993',
+ "lrarr;": '\U000021C6',
+ "lrcorner;": '\U0000231F',
+ "lrhar;": '\U000021CB',
+ "lrhard;": '\U0000296D',
+ "lrm;": '\U0000200E',
+ "lrtri;": '\U000022BF',
+ "lsaquo;": '\U00002039',
+ "lscr;": '\U0001D4C1',
+ "lsh;": '\U000021B0',
+ "lsim;": '\U00002272',
+ "lsime;": '\U00002A8D',
+ "lsimg;": '\U00002A8F',
+ "lsqb;": '\U0000005B',
+ "lsquo;": '\U00002018',
+ "lsquor;": '\U0000201A',
+ "lstrok;": '\U00000142',
+ "lt;": '\U0000003C',
+ "ltcc;": '\U00002AA6',
+ "ltcir;": '\U00002A79',
+ "ltdot;": '\U000022D6',
+ "lthree;": '\U000022CB',
+ "ltimes;": '\U000022C9',
+ "ltlarr;": '\U00002976',
+ "ltquest;": '\U00002A7B',
+ "ltrPar;": '\U00002996',
+ "ltri;": '\U000025C3',
+ "ltrie;": '\U000022B4',
+ "ltrif;": '\U000025C2',
+ "lurdshar;": '\U0000294A',
+ "luruhar;": '\U00002966',
+ "mDDot;": '\U0000223A',
+ "macr;": '\U000000AF',
+ "male;": '\U00002642',
+ "malt;": '\U00002720',
+ "maltese;": '\U00002720',
+ "map;": '\U000021A6',
+ "mapsto;": '\U000021A6',
+ "mapstodown;": '\U000021A7',
+ "mapstoleft;": '\U000021A4',
+ "mapstoup;": '\U000021A5',
+ "marker;": '\U000025AE',
+ "mcomma;": '\U00002A29',
+ "mcy;": '\U0000043C',
+ "mdash;": '\U00002014',
+ "measuredangle;": '\U00002221',
+ "mfr;": '\U0001D52A',
+ "mho;": '\U00002127',
+ "micro;": '\U000000B5',
+ "mid;": '\U00002223',
+ "midast;": '\U0000002A',
+ "midcir;": '\U00002AF0',
+ "middot;": '\U000000B7',
+ "minus;": '\U00002212',
+ "minusb;": '\U0000229F',
+ "minusd;": '\U00002238',
+ "minusdu;": '\U00002A2A',
+ "mlcp;": '\U00002ADB',
+ "mldr;": '\U00002026',
+ "mnplus;": '\U00002213',
+ "models;": '\U000022A7',
+ "mopf;": '\U0001D55E',
+ "mp;": '\U00002213',
+ "mscr;": '\U0001D4C2',
+ "mstpos;": '\U0000223E',
+ "mu;": '\U000003BC',
+ "multimap;": '\U000022B8',
+ "mumap;": '\U000022B8',
+ "nLeftarrow;": '\U000021CD',
+ "nLeftrightarrow;": '\U000021CE',
+ "nRightarrow;": '\U000021CF',
+ "nVDash;": '\U000022AF',
+ "nVdash;": '\U000022AE',
+ "nabla;": '\U00002207',
+ "nacute;": '\U00000144',
+ "nap;": '\U00002249',
+ "napos;": '\U00000149',
+ "napprox;": '\U00002249',
+ "natur;": '\U0000266E',
+ "natural;": '\U0000266E',
+ "naturals;": '\U00002115',
+ "nbsp;": '\U000000A0',
+ "ncap;": '\U00002A43',
+ "ncaron;": '\U00000148',
+ "ncedil;": '\U00000146',
+ "ncong;": '\U00002247',
+ "ncup;": '\U00002A42',
+ "ncy;": '\U0000043D',
+ "ndash;": '\U00002013',
+ "ne;": '\U00002260',
+ "neArr;": '\U000021D7',
+ "nearhk;": '\U00002924',
+ "nearr;": '\U00002197',
+ "nearrow;": '\U00002197',
+ "nequiv;": '\U00002262',
+ "nesear;": '\U00002928',
+ "nexist;": '\U00002204',
+ "nexists;": '\U00002204',
+ "nfr;": '\U0001D52B',
+ "nge;": '\U00002271',
+ "ngeq;": '\U00002271',
+ "ngsim;": '\U00002275',
+ "ngt;": '\U0000226F',
+ "ngtr;": '\U0000226F',
+ "nhArr;": '\U000021CE',
+ "nharr;": '\U000021AE',
+ "nhpar;": '\U00002AF2',
+ "ni;": '\U0000220B',
+ "nis;": '\U000022FC',
+ "nisd;": '\U000022FA',
+ "niv;": '\U0000220B',
+ "njcy;": '\U0000045A',
+ "nlArr;": '\U000021CD',
+ "nlarr;": '\U0000219A',
+ "nldr;": '\U00002025',
+ "nle;": '\U00002270',
+ "nleftarrow;": '\U0000219A',
+ "nleftrightarrow;": '\U000021AE',
+ "nleq;": '\U00002270',
+ "nless;": '\U0000226E',
+ "nlsim;": '\U00002274',
+ "nlt;": '\U0000226E',
+ "nltri;": '\U000022EA',
+ "nltrie;": '\U000022EC',
+ "nmid;": '\U00002224',
+ "nopf;": '\U0001D55F',
+ "not;": '\U000000AC',
+ "notin;": '\U00002209',
+ "notinva;": '\U00002209',
+ "notinvb;": '\U000022F7',
+ "notinvc;": '\U000022F6',
+ "notni;": '\U0000220C',
+ "notniva;": '\U0000220C',
+ "notnivb;": '\U000022FE',
+ "notnivc;": '\U000022FD',
+ "npar;": '\U00002226',
+ "nparallel;": '\U00002226',
+ "npolint;": '\U00002A14',
+ "npr;": '\U00002280',
+ "nprcue;": '\U000022E0',
+ "nprec;": '\U00002280',
+ "nrArr;": '\U000021CF',
+ "nrarr;": '\U0000219B',
+ "nrightarrow;": '\U0000219B',
+ "nrtri;": '\U000022EB',
+ "nrtrie;": '\U000022ED',
+ "nsc;": '\U00002281',
+ "nsccue;": '\U000022E1',
+ "nscr;": '\U0001D4C3',
+ "nshortmid;": '\U00002224',
+ "nshortparallel;": '\U00002226',
+ "nsim;": '\U00002241',
+ "nsime;": '\U00002244',
+ "nsimeq;": '\U00002244',
+ "nsmid;": '\U00002224',
+ "nspar;": '\U00002226',
+ "nsqsube;": '\U000022E2',
+ "nsqsupe;": '\U000022E3',
+ "nsub;": '\U00002284',
+ "nsube;": '\U00002288',
+ "nsubseteq;": '\U00002288',
+ "nsucc;": '\U00002281',
+ "nsup;": '\U00002285',
+ "nsupe;": '\U00002289',
+ "nsupseteq;": '\U00002289',
+ "ntgl;": '\U00002279',
+ "ntilde;": '\U000000F1',
+ "ntlg;": '\U00002278',
+ "ntriangleleft;": '\U000022EA',
+ "ntrianglelefteq;": '\U000022EC',
+ "ntriangleright;": '\U000022EB',
+ "ntrianglerighteq;": '\U000022ED',
+ "nu;": '\U000003BD',
+ "num;": '\U00000023',
+ "numero;": '\U00002116',
+ "numsp;": '\U00002007',
+ "nvDash;": '\U000022AD',
+ "nvHarr;": '\U00002904',
+ "nvdash;": '\U000022AC',
+ "nvinfin;": '\U000029DE',
+ "nvlArr;": '\U00002902',
+ "nvrArr;": '\U00002903',
+ "nwArr;": '\U000021D6',
+ "nwarhk;": '\U00002923',
+ "nwarr;": '\U00002196',
+ "nwarrow;": '\U00002196',
+ "nwnear;": '\U00002927',
+ "oS;": '\U000024C8',
+ "oacute;": '\U000000F3',
+ "oast;": '\U0000229B',
+ "ocir;": '\U0000229A',
+ "ocirc;": '\U000000F4',
+ "ocy;": '\U0000043E',
+ "odash;": '\U0000229D',
+ "odblac;": '\U00000151',
+ "odiv;": '\U00002A38',
+ "odot;": '\U00002299',
+ "odsold;": '\U000029BC',
+ "oelig;": '\U00000153',
+ "ofcir;": '\U000029BF',
+ "ofr;": '\U0001D52C',
+ "ogon;": '\U000002DB',
+ "ograve;": '\U000000F2',
+ "ogt;": '\U000029C1',
+ "ohbar;": '\U000029B5',
+ "ohm;": '\U000003A9',
+ "oint;": '\U0000222E',
+ "olarr;": '\U000021BA',
+ "olcir;": '\U000029BE',
+ "olcross;": '\U000029BB',
+ "oline;": '\U0000203E',
+ "olt;": '\U000029C0',
+ "omacr;": '\U0000014D',
+ "omega;": '\U000003C9',
+ "omicron;": '\U000003BF',
+ "omid;": '\U000029B6',
+ "ominus;": '\U00002296',
+ "oopf;": '\U0001D560',
+ "opar;": '\U000029B7',
+ "operp;": '\U000029B9',
+ "oplus;": '\U00002295',
+ "or;": '\U00002228',
+ "orarr;": '\U000021BB',
+ "ord;": '\U00002A5D',
+ "order;": '\U00002134',
+ "orderof;": '\U00002134',
+ "ordf;": '\U000000AA',
+ "ordm;": '\U000000BA',
+ "origof;": '\U000022B6',
+ "oror;": '\U00002A56',
+ "orslope;": '\U00002A57',
+ "orv;": '\U00002A5B',
+ "oscr;": '\U00002134',
+ "oslash;": '\U000000F8',
+ "osol;": '\U00002298',
+ "otilde;": '\U000000F5',
+ "otimes;": '\U00002297',
+ "otimesas;": '\U00002A36',
+ "ouml;": '\U000000F6',
+ "ovbar;": '\U0000233D',
+ "par;": '\U00002225',
+ "para;": '\U000000B6',
+ "parallel;": '\U00002225',
+ "parsim;": '\U00002AF3',
+ "parsl;": '\U00002AFD',
+ "part;": '\U00002202',
+ "pcy;": '\U0000043F',
+ "percnt;": '\U00000025',
+ "period;": '\U0000002E',
+ "permil;": '\U00002030',
+ "perp;": '\U000022A5',
+ "pertenk;": '\U00002031',
+ "pfr;": '\U0001D52D',
+ "phi;": '\U000003C6',
+ "phiv;": '\U000003D5',
+ "phmmat;": '\U00002133',
+ "phone;": '\U0000260E',
+ "pi;": '\U000003C0',
+ "pitchfork;": '\U000022D4',
+ "piv;": '\U000003D6',
+ "planck;": '\U0000210F',
+ "planckh;": '\U0000210E',
+ "plankv;": '\U0000210F',
+ "plus;": '\U0000002B',
+ "plusacir;": '\U00002A23',
+ "plusb;": '\U0000229E',
+ "pluscir;": '\U00002A22',
+ "plusdo;": '\U00002214',
+ "plusdu;": '\U00002A25',
+ "pluse;": '\U00002A72',
+ "plusmn;": '\U000000B1',
+ "plussim;": '\U00002A26',
+ "plustwo;": '\U00002A27',
+ "pm;": '\U000000B1',
+ "pointint;": '\U00002A15',
+ "popf;": '\U0001D561',
+ "pound;": '\U000000A3',
+ "pr;": '\U0000227A',
+ "prE;": '\U00002AB3',
+ "prap;": '\U00002AB7',
+ "prcue;": '\U0000227C',
+ "pre;": '\U00002AAF',
+ "prec;": '\U0000227A',
+ "precapprox;": '\U00002AB7',
+ "preccurlyeq;": '\U0000227C',
+ "preceq;": '\U00002AAF',
+ "precnapprox;": '\U00002AB9',
+ "precneqq;": '\U00002AB5',
+ "precnsim;": '\U000022E8',
+ "precsim;": '\U0000227E',
+ "prime;": '\U00002032',
+ "primes;": '\U00002119',
+ "prnE;": '\U00002AB5',
+ "prnap;": '\U00002AB9',
+ "prnsim;": '\U000022E8',
+ "prod;": '\U0000220F',
+ "profalar;": '\U0000232E',
+ "profline;": '\U00002312',
+ "profsurf;": '\U00002313',
+ "prop;": '\U0000221D',
+ "propto;": '\U0000221D',
+ "prsim;": '\U0000227E',
+ "prurel;": '\U000022B0',
+ "pscr;": '\U0001D4C5',
+ "psi;": '\U000003C8',
+ "puncsp;": '\U00002008',
+ "qfr;": '\U0001D52E',
+ "qint;": '\U00002A0C',
+ "qopf;": '\U0001D562',
+ "qprime;": '\U00002057',
+ "qscr;": '\U0001D4C6',
+ "quaternions;": '\U0000210D',
+ "quatint;": '\U00002A16',
+ "quest;": '\U0000003F',
+ "questeq;": '\U0000225F',
+ "quot;": '\U00000022',
+ "rAarr;": '\U000021DB',
+ "rArr;": '\U000021D2',
+ "rAtail;": '\U0000291C',
+ "rBarr;": '\U0000290F',
+ "rHar;": '\U00002964',
+ "racute;": '\U00000155',
+ "radic;": '\U0000221A',
+ "raemptyv;": '\U000029B3',
+ "rang;": '\U000027E9',
+ "rangd;": '\U00002992',
+ "range;": '\U000029A5',
+ "rangle;": '\U000027E9',
+ "raquo;": '\U000000BB',
+ "rarr;": '\U00002192',
+ "rarrap;": '\U00002975',
+ "rarrb;": '\U000021E5',
+ "rarrbfs;": '\U00002920',
+ "rarrc;": '\U00002933',
+ "rarrfs;": '\U0000291E',
+ "rarrhk;": '\U000021AA',
+ "rarrlp;": '\U000021AC',
+ "rarrpl;": '\U00002945',
+ "rarrsim;": '\U00002974',
+ "rarrtl;": '\U000021A3',
+ "rarrw;": '\U0000219D',
+ "ratail;": '\U0000291A',
+ "ratio;": '\U00002236',
+ "rationals;": '\U0000211A',
+ "rbarr;": '\U0000290D',
+ "rbbrk;": '\U00002773',
+ "rbrace;": '\U0000007D',
+ "rbrack;": '\U0000005D',
+ "rbrke;": '\U0000298C',
+ "rbrksld;": '\U0000298E',
+ "rbrkslu;": '\U00002990',
+ "rcaron;": '\U00000159',
+ "rcedil;": '\U00000157',
+ "rceil;": '\U00002309',
+ "rcub;": '\U0000007D',
+ "rcy;": '\U00000440',
+ "rdca;": '\U00002937',
+ "rdldhar;": '\U00002969',
+ "rdquo;": '\U0000201D',
+ "rdquor;": '\U0000201D',
+ "rdsh;": '\U000021B3',
+ "real;": '\U0000211C',
+ "realine;": '\U0000211B',
+ "realpart;": '\U0000211C',
+ "reals;": '\U0000211D',
+ "rect;": '\U000025AD',
+ "reg;": '\U000000AE',
+ "rfisht;": '\U0000297D',
+ "rfloor;": '\U0000230B',
+ "rfr;": '\U0001D52F',
+ "rhard;": '\U000021C1',
+ "rharu;": '\U000021C0',
+ "rharul;": '\U0000296C',
+ "rho;": '\U000003C1',
+ "rhov;": '\U000003F1',
+ "rightarrow;": '\U00002192',
+ "rightarrowtail;": '\U000021A3',
+ "rightharpoondown;": '\U000021C1',
+ "rightharpoonup;": '\U000021C0',
+ "rightleftarrows;": '\U000021C4',
+ "rightleftharpoons;": '\U000021CC',
+ "rightrightarrows;": '\U000021C9',
+ "rightsquigarrow;": '\U0000219D',
+ "rightthreetimes;": '\U000022CC',
+ "ring;": '\U000002DA',
+ "risingdotseq;": '\U00002253',
+ "rlarr;": '\U000021C4',
+ "rlhar;": '\U000021CC',
+ "rlm;": '\U0000200F',
+ "rmoust;": '\U000023B1',
+ "rmoustache;": '\U000023B1',
+ "rnmid;": '\U00002AEE',
+ "roang;": '\U000027ED',
+ "roarr;": '\U000021FE',
+ "robrk;": '\U000027E7',
+ "ropar;": '\U00002986',
+ "ropf;": '\U0001D563',
+ "roplus;": '\U00002A2E',
+ "rotimes;": '\U00002A35',
+ "rpar;": '\U00000029',
+ "rpargt;": '\U00002994',
+ "rppolint;": '\U00002A12',
+ "rrarr;": '\U000021C9',
+ "rsaquo;": '\U0000203A',
+ "rscr;": '\U0001D4C7',
+ "rsh;": '\U000021B1',
+ "rsqb;": '\U0000005D',
+ "rsquo;": '\U00002019',
+ "rsquor;": '\U00002019',
+ "rthree;": '\U000022CC',
+ "rtimes;": '\U000022CA',
+ "rtri;": '\U000025B9',
+ "rtrie;": '\U000022B5',
+ "rtrif;": '\U000025B8',
+ "rtriltri;": '\U000029CE',
+ "ruluhar;": '\U00002968',
+ "rx;": '\U0000211E',
+ "sacute;": '\U0000015B',
+ "sbquo;": '\U0000201A',
+ "sc;": '\U0000227B',
+ "scE;": '\U00002AB4',
+ "scap;": '\U00002AB8',
+ "scaron;": '\U00000161',
+ "sccue;": '\U0000227D',
+ "sce;": '\U00002AB0',
+ "scedil;": '\U0000015F',
+ "scirc;": '\U0000015D',
+ "scnE;": '\U00002AB6',
+ "scnap;": '\U00002ABA',
+ "scnsim;": '\U000022E9',
+ "scpolint;": '\U00002A13',
+ "scsim;": '\U0000227F',
+ "scy;": '\U00000441',
+ "sdot;": '\U000022C5',
+ "sdotb;": '\U000022A1',
+ "sdote;": '\U00002A66',
+ "seArr;": '\U000021D8',
+ "searhk;": '\U00002925',
+ "searr;": '\U00002198',
+ "searrow;": '\U00002198',
+ "sect;": '\U000000A7',
+ "semi;": '\U0000003B',
+ "seswar;": '\U00002929',
+ "setminus;": '\U00002216',
+ "setmn;": '\U00002216',
+ "sext;": '\U00002736',
+ "sfr;": '\U0001D530',
+ "sfrown;": '\U00002322',
+ "sharp;": '\U0000266F',
+ "shchcy;": '\U00000449',
+ "shcy;": '\U00000448',
+ "shortmid;": '\U00002223',
+ "shortparallel;": '\U00002225',
+ "shy;": '\U000000AD',
+ "sigma;": '\U000003C3',
+ "sigmaf;": '\U000003C2',
+ "sigmav;": '\U000003C2',
+ "sim;": '\U0000223C',
+ "simdot;": '\U00002A6A',
+ "sime;": '\U00002243',
+ "simeq;": '\U00002243',
+ "simg;": '\U00002A9E',
+ "simgE;": '\U00002AA0',
+ "siml;": '\U00002A9D',
+ "simlE;": '\U00002A9F',
+ "simne;": '\U00002246',
+ "simplus;": '\U00002A24',
+ "simrarr;": '\U00002972',
+ "slarr;": '\U00002190',
+ "smallsetminus;": '\U00002216',
+ "smashp;": '\U00002A33',
+ "smeparsl;": '\U000029E4',
+ "smid;": '\U00002223',
+ "smile;": '\U00002323',
+ "smt;": '\U00002AAA',
+ "smte;": '\U00002AAC',
+ "softcy;": '\U0000044C',
+ "sol;": '\U0000002F',
+ "solb;": '\U000029C4',
+ "solbar;": '\U0000233F',
+ "sopf;": '\U0001D564',
+ "spades;": '\U00002660',
+ "spadesuit;": '\U00002660',
+ "spar;": '\U00002225',
+ "sqcap;": '\U00002293',
+ "sqcup;": '\U00002294',
+ "sqsub;": '\U0000228F',
+ "sqsube;": '\U00002291',
+ "sqsubset;": '\U0000228F',
+ "sqsubseteq;": '\U00002291',
+ "sqsup;": '\U00002290',
+ "sqsupe;": '\U00002292',
+ "sqsupset;": '\U00002290',
+ "sqsupseteq;": '\U00002292',
+ "squ;": '\U000025A1',
+ "square;": '\U000025A1',
+ "squarf;": '\U000025AA',
+ "squf;": '\U000025AA',
+ "srarr;": '\U00002192',
+ "sscr;": '\U0001D4C8',
+ "ssetmn;": '\U00002216',
+ "ssmile;": '\U00002323',
+ "sstarf;": '\U000022C6',
+ "star;": '\U00002606',
+ "starf;": '\U00002605',
+ "straightepsilon;": '\U000003F5',
+ "straightphi;": '\U000003D5',
+ "strns;": '\U000000AF',
+ "sub;": '\U00002282',
+ "subE;": '\U00002AC5',
+ "subdot;": '\U00002ABD',
+ "sube;": '\U00002286',
+ "subedot;": '\U00002AC3',
+ "submult;": '\U00002AC1',
+ "subnE;": '\U00002ACB',
+ "subne;": '\U0000228A',
+ "subplus;": '\U00002ABF',
+ "subrarr;": '\U00002979',
+ "subset;": '\U00002282',
+ "subseteq;": '\U00002286',
+ "subseteqq;": '\U00002AC5',
+ "subsetneq;": '\U0000228A',
+ "subsetneqq;": '\U00002ACB',
+ "subsim;": '\U00002AC7',
+ "subsub;": '\U00002AD5',
+ "subsup;": '\U00002AD3',
+ "succ;": '\U0000227B',
+ "succapprox;": '\U00002AB8',
+ "succcurlyeq;": '\U0000227D',
+ "succeq;": '\U00002AB0',
+ "succnapprox;": '\U00002ABA',
+ "succneqq;": '\U00002AB6',
+ "succnsim;": '\U000022E9',
+ "succsim;": '\U0000227F',
+ "sum;": '\U00002211',
+ "sung;": '\U0000266A',
+ "sup;": '\U00002283',
+ "sup1;": '\U000000B9',
+ "sup2;": '\U000000B2',
+ "sup3;": '\U000000B3',
+ "supE;": '\U00002AC6',
+ "supdot;": '\U00002ABE',
+ "supdsub;": '\U00002AD8',
+ "supe;": '\U00002287',
+ "supedot;": '\U00002AC4',
+ "suphsol;": '\U000027C9',
+ "suphsub;": '\U00002AD7',
+ "suplarr;": '\U0000297B',
+ "supmult;": '\U00002AC2',
+ "supnE;": '\U00002ACC',
+ "supne;": '\U0000228B',
+ "supplus;": '\U00002AC0',
+ "supset;": '\U00002283',
+ "supseteq;": '\U00002287',
+ "supseteqq;": '\U00002AC6',
+ "supsetneq;": '\U0000228B',
+ "supsetneqq;": '\U00002ACC',
+ "supsim;": '\U00002AC8',
+ "supsub;": '\U00002AD4',
+ "supsup;": '\U00002AD6',
+ "swArr;": '\U000021D9',
+ "swarhk;": '\U00002926',
+ "swarr;": '\U00002199',
+ "swarrow;": '\U00002199',
+ "swnwar;": '\U0000292A',
+ "szlig;": '\U000000DF',
+ "target;": '\U00002316',
+ "tau;": '\U000003C4',
+ "tbrk;": '\U000023B4',
+ "tcaron;": '\U00000165',
+ "tcedil;": '\U00000163',
+ "tcy;": '\U00000442',
+ "tdot;": '\U000020DB',
+ "telrec;": '\U00002315',
+ "tfr;": '\U0001D531',
+ "there4;": '\U00002234',
+ "therefore;": '\U00002234',
+ "theta;": '\U000003B8',
+ "thetasym;": '\U000003D1',
+ "thetav;": '\U000003D1',
+ "thickapprox;": '\U00002248',
+ "thicksim;": '\U0000223C',
+ "thinsp;": '\U00002009',
+ "thkap;": '\U00002248',
+ "thksim;": '\U0000223C',
+ "thorn;": '\U000000FE',
+ "tilde;": '\U000002DC',
+ "times;": '\U000000D7',
+ "timesb;": '\U000022A0',
+ "timesbar;": '\U00002A31',
+ "timesd;": '\U00002A30',
+ "tint;": '\U0000222D',
+ "toea;": '\U00002928',
+ "top;": '\U000022A4',
+ "topbot;": '\U00002336',
+ "topcir;": '\U00002AF1',
+ "topf;": '\U0001D565',
+ "topfork;": '\U00002ADA',
+ "tosa;": '\U00002929',
+ "tprime;": '\U00002034',
+ "trade;": '\U00002122',
+ "triangle;": '\U000025B5',
+ "triangledown;": '\U000025BF',
+ "triangleleft;": '\U000025C3',
+ "trianglelefteq;": '\U000022B4',
+ "triangleq;": '\U0000225C',
+ "triangleright;": '\U000025B9',
+ "trianglerighteq;": '\U000022B5',
+ "tridot;": '\U000025EC',
+ "trie;": '\U0000225C',
+ "triminus;": '\U00002A3A',
+ "triplus;": '\U00002A39',
+ "trisb;": '\U000029CD',
+ "tritime;": '\U00002A3B',
+ "trpezium;": '\U000023E2',
+ "tscr;": '\U0001D4C9',
+ "tscy;": '\U00000446',
+ "tshcy;": '\U0000045B',
+ "tstrok;": '\U00000167',
+ "twixt;": '\U0000226C',
+ "twoheadleftarrow;": '\U0000219E',
+ "twoheadrightarrow;": '\U000021A0',
+ "uArr;": '\U000021D1',
+ "uHar;": '\U00002963',
+ "uacute;": '\U000000FA',
+ "uarr;": '\U00002191',
+ "ubrcy;": '\U0000045E',
+ "ubreve;": '\U0000016D',
+ "ucirc;": '\U000000FB',
+ "ucy;": '\U00000443',
+ "udarr;": '\U000021C5',
+ "udblac;": '\U00000171',
+ "udhar;": '\U0000296E',
+ "ufisht;": '\U0000297E',
+ "ufr;": '\U0001D532',
+ "ugrave;": '\U000000F9',
+ "uharl;": '\U000021BF',
+ "uharr;": '\U000021BE',
+ "uhblk;": '\U00002580',
+ "ulcorn;": '\U0000231C',
+ "ulcorner;": '\U0000231C',
+ "ulcrop;": '\U0000230F',
+ "ultri;": '\U000025F8',
+ "umacr;": '\U0000016B',
+ "uml;": '\U000000A8',
+ "uogon;": '\U00000173',
+ "uopf;": '\U0001D566',
+ "uparrow;": '\U00002191',
+ "updownarrow;": '\U00002195',
+ "upharpoonleft;": '\U000021BF',
+ "upharpoonright;": '\U000021BE',
+ "uplus;": '\U0000228E',
+ "upsi;": '\U000003C5',
+ "upsih;": '\U000003D2',
+ "upsilon;": '\U000003C5',
+ "upuparrows;": '\U000021C8',
+ "urcorn;": '\U0000231D',
+ "urcorner;": '\U0000231D',
+ "urcrop;": '\U0000230E',
+ "uring;": '\U0000016F',
+ "urtri;": '\U000025F9',
+ "uscr;": '\U0001D4CA',
+ "utdot;": '\U000022F0',
+ "utilde;": '\U00000169',
+ "utri;": '\U000025B5',
+ "utrif;": '\U000025B4',
+ "uuarr;": '\U000021C8',
+ "uuml;": '\U000000FC',
+ "uwangle;": '\U000029A7',
+ "vArr;": '\U000021D5',
+ "vBar;": '\U00002AE8',
+ "vBarv;": '\U00002AE9',
+ "vDash;": '\U000022A8',
+ "vangrt;": '\U0000299C',
+ "varepsilon;": '\U000003F5',
+ "varkappa;": '\U000003F0',
+ "varnothing;": '\U00002205',
+ "varphi;": '\U000003D5',
+ "varpi;": '\U000003D6',
+ "varpropto;": '\U0000221D',
+ "varr;": '\U00002195',
+ "varrho;": '\U000003F1',
+ "varsigma;": '\U000003C2',
+ "vartheta;": '\U000003D1',
+ "vartriangleleft;": '\U000022B2',
+ "vartriangleright;": '\U000022B3',
+ "vcy;": '\U00000432',
+ "vdash;": '\U000022A2',
+ "vee;": '\U00002228',
+ "veebar;": '\U000022BB',
+ "veeeq;": '\U0000225A',
+ "vellip;": '\U000022EE',
+ "verbar;": '\U0000007C',
+ "vert;": '\U0000007C',
+ "vfr;": '\U0001D533',
+ "vltri;": '\U000022B2',
+ "vopf;": '\U0001D567',
+ "vprop;": '\U0000221D',
+ "vrtri;": '\U000022B3',
+ "vscr;": '\U0001D4CB',
+ "vzigzag;": '\U0000299A',
+ "wcirc;": '\U00000175',
+ "wedbar;": '\U00002A5F',
+ "wedge;": '\U00002227',
+ "wedgeq;": '\U00002259',
+ "weierp;": '\U00002118',
+ "wfr;": '\U0001D534',
+ "wopf;": '\U0001D568',
+ "wp;": '\U00002118',
+ "wr;": '\U00002240',
+ "wreath;": '\U00002240',
+ "wscr;": '\U0001D4CC',
+ "xcap;": '\U000022C2',
+ "xcirc;": '\U000025EF',
+ "xcup;": '\U000022C3',
+ "xdtri;": '\U000025BD',
+ "xfr;": '\U0001D535',
+ "xhArr;": '\U000027FA',
+ "xharr;": '\U000027F7',
+ "xi;": '\U000003BE',
+ "xlArr;": '\U000027F8',
+ "xlarr;": '\U000027F5',
+ "xmap;": '\U000027FC',
+ "xnis;": '\U000022FB',
+ "xodot;": '\U00002A00',
+ "xopf;": '\U0001D569',
+ "xoplus;": '\U00002A01',
+ "xotime;": '\U00002A02',
+ "xrArr;": '\U000027F9',
+ "xrarr;": '\U000027F6',
+ "xscr;": '\U0001D4CD',
+ "xsqcup;": '\U00002A06',
+ "xuplus;": '\U00002A04',
+ "xutri;": '\U000025B3',
+ "xvee;": '\U000022C1',
+ "xwedge;": '\U000022C0',
+ "yacute;": '\U000000FD',
+ "yacy;": '\U0000044F',
+ "ycirc;": '\U00000177',
+ "ycy;": '\U0000044B',
+ "yen;": '\U000000A5',
+ "yfr;": '\U0001D536',
+ "yicy;": '\U00000457',
+ "yopf;": '\U0001D56A',
+ "yscr;": '\U0001D4CE',
+ "yucy;": '\U0000044E',
+ "yuml;": '\U000000FF',
+ "zacute;": '\U0000017A',
+ "zcaron;": '\U0000017E',
+ "zcy;": '\U00000437',
+ "zdot;": '\U0000017C',
+ "zeetrf;": '\U00002128',
+ "zeta;": '\U000003B6',
+ "zfr;": '\U0001D537',
+ "zhcy;": '\U00000436',
+ "zigrarr;": '\U000021DD',
+ "zopf;": '\U0001D56B',
+ "zscr;": '\U0001D4CF',
+ "zwj;": '\U0000200D',
+ "zwnj;": '\U0000200C',
+ "AElig": '\U000000C6',
+ "AMP": '\U00000026',
+ "Aacute": '\U000000C1',
+ "Acirc": '\U000000C2',
+ "Agrave": '\U000000C0',
+ "Aring": '\U000000C5',
+ "Atilde": '\U000000C3',
+ "Auml": '\U000000C4',
+ "COPY": '\U000000A9',
+ "Ccedil": '\U000000C7',
+ "ETH": '\U000000D0',
+ "Eacute": '\U000000C9',
+ "Ecirc": '\U000000CA',
+ "Egrave": '\U000000C8',
+ "Euml": '\U000000CB',
+ "GT": '\U0000003E',
+ "Iacute": '\U000000CD',
+ "Icirc": '\U000000CE',
+ "Igrave": '\U000000CC',
+ "Iuml": '\U000000CF',
+ "LT": '\U0000003C',
+ "Ntilde": '\U000000D1',
+ "Oacute": '\U000000D3',
+ "Ocirc": '\U000000D4',
+ "Ograve": '\U000000D2',
+ "Oslash": '\U000000D8',
+ "Otilde": '\U000000D5',
+ "Ouml": '\U000000D6',
+ "QUOT": '\U00000022',
+ "REG": '\U000000AE',
+ "THORN": '\U000000DE',
+ "Uacute": '\U000000DA',
+ "Ucirc": '\U000000DB',
+ "Ugrave": '\U000000D9',
+ "Uuml": '\U000000DC',
+ "Yacute": '\U000000DD',
+ "aacute": '\U000000E1',
+ "acirc": '\U000000E2',
+ "acute": '\U000000B4',
+ "aelig": '\U000000E6',
+ "agrave": '\U000000E0',
+ "amp": '\U00000026',
+ "aring": '\U000000E5',
+ "atilde": '\U000000E3',
+ "auml": '\U000000E4',
+ "brvbar": '\U000000A6',
+ "ccedil": '\U000000E7',
+ "cedil": '\U000000B8',
+ "cent": '\U000000A2',
+ "copy": '\U000000A9',
+ "curren": '\U000000A4',
+ "deg": '\U000000B0',
+ "divide": '\U000000F7',
+ "eacute": '\U000000E9',
+ "ecirc": '\U000000EA',
+ "egrave": '\U000000E8',
+ "eth": '\U000000F0',
+ "euml": '\U000000EB',
+ "frac12": '\U000000BD',
+ "frac14": '\U000000BC',
+ "frac34": '\U000000BE',
+ "gt": '\U0000003E',
+ "iacute": '\U000000ED',
+ "icirc": '\U000000EE',
+ "iexcl": '\U000000A1',
+ "igrave": '\U000000EC',
+ "iquest": '\U000000BF',
+ "iuml": '\U000000EF',
+ "laquo": '\U000000AB',
+ "lt": '\U0000003C',
+ "macr": '\U000000AF',
+ "micro": '\U000000B5',
+ "middot": '\U000000B7',
+ "nbsp": '\U000000A0',
+ "not": '\U000000AC',
+ "ntilde": '\U000000F1',
+ "oacute": '\U000000F3',
+ "ocirc": '\U000000F4',
+ "ograve": '\U000000F2',
+ "ordf": '\U000000AA',
+ "ordm": '\U000000BA',
+ "oslash": '\U000000F8',
+ "otilde": '\U000000F5',
+ "ouml": '\U000000F6',
+ "para": '\U000000B6',
+ "plusmn": '\U000000B1',
+ "pound": '\U000000A3',
+ "quot": '\U00000022',
+ "raquo": '\U000000BB',
+ "reg": '\U000000AE',
+ "sect": '\U000000A7',
+ "shy": '\U000000AD',
+ "sup1": '\U000000B9',
+ "sup2": '\U000000B2',
+ "sup3": '\U000000B3',
+ "szlig": '\U000000DF',
+ "thorn": '\U000000FE',
+ "times": '\U000000D7',
+ "uacute": '\U000000FA',
+ "ucirc": '\U000000FB',
+ "ugrave": '\U000000F9',
+ "uml": '\U000000A8',
+ "uuml": '\U000000FC',
+ "yacute": '\U000000FD',
+ "yen": '\U000000A5',
+ "yuml": '\U000000FF',
}
// HTML entities that are two unicode codepoints.
diff --git a/vendor/golang.org/x/net/html/foreign.go b/vendor/golang.org/x/net/html/foreign.go
index d3b3844..01477a9 100644
--- a/vendor/golang.org/x/net/html/foreign.go
+++ b/vendor/golang.org/x/net/html/foreign.go
@@ -67,7 +67,7 @@ func mathMLTextIntegrationPoint(n *Node) bool {
return false
}
-// Section 12.2.5.5.
+// Section 12.2.6.5.
var breakout = map[string]bool{
"b": true,
"big": true,
@@ -115,7 +115,7 @@ var breakout = map[string]bool{
"var": true,
}
-// Section 12.2.5.5.
+// Section 12.2.6.5.
var svgTagNameAdjustments = map[string]string{
"altglyph": "altGlyph",
"altglyphdef": "altGlyphDef",
@@ -155,7 +155,7 @@ var svgTagNameAdjustments = map[string]string{
"textpath": "textPath",
}
-// Section 12.2.5.1
+// Section 12.2.6.1
var mathMLAttributeAdjustments = map[string]string{
"definitionurl": "definitionURL",
}
diff --git a/vendor/golang.org/x/net/html/node.go b/vendor/golang.org/x/net/html/node.go
index 26b657a..633ee15 100644
--- a/vendor/golang.org/x/net/html/node.go
+++ b/vendor/golang.org/x/net/html/node.go
@@ -21,9 +21,10 @@ const (
scopeMarkerNode
)
-// Section 12.2.3.3 says "scope markers are inserted when entering applet
-// elements, buttons, object elements, marquees, table cells, and table
-// captions, and are used to prevent formatting from 'leaking'".
+// Section 12.2.4.3 says "The markers are inserted when entering applet,
+// object, marquee, template, td, th, and caption elements, and are used
+// to prevent formatting from "leaking" into applet, object, marquee,
+// template, td, th, and caption elements".
var scopeMarker = Node{Type: scopeMarkerNode}
// A Node consists of a NodeType and some Data (tag name for element nodes,
@@ -173,6 +174,16 @@ func (s *nodeStack) index(n *Node) int {
return -1
}
+// contains returns whether a is within s.
+func (s *nodeStack) contains(a atom.Atom) bool {
+ for _, n := range *s {
+ if n.DataAtom == a && n.Namespace == "" {
+ return true
+ }
+ }
+ return false
+}
+
// insert inserts a node at the given index.
func (s *nodeStack) insert(i int, n *Node) {
(*s) = append(*s, nil)
@@ -191,3 +202,19 @@ func (s *nodeStack) remove(n *Node) {
(*s)[j] = nil
*s = (*s)[:j]
}
+
+type insertionModeStack []insertionMode
+
+func (s *insertionModeStack) pop() (im insertionMode) {
+ i := len(*s)
+ im = (*s)[i-1]
+ *s = (*s)[:i-1]
+ return im
+}
+
+func (s *insertionModeStack) top() insertionMode {
+ if i := len(*s); i > 0 {
+ return (*s)[i-1]
+ }
+ return nil
+}
diff --git a/vendor/golang.org/x/net/html/parse.go b/vendor/golang.org/x/net/html/parse.go
index be4b2bf..992cff2 100644
--- a/vendor/golang.org/x/net/html/parse.go
+++ b/vendor/golang.org/x/net/html/parse.go
@@ -25,20 +25,22 @@ type parser struct {
hasSelfClosingToken bool
// doc is the document root element.
doc *Node
- // The stack of open elements (section 12.2.3.2) and active formatting
- // elements (section 12.2.3.3).
+ // The stack of open elements (section 12.2.4.2) and active formatting
+ // elements (section 12.2.4.3).
oe, afe nodeStack
- // Element pointers (section 12.2.3.4).
+ // Element pointers (section 12.2.4.4).
head, form *Node
- // Other parsing state flags (section 12.2.3.5).
+ // Other parsing state flags (section 12.2.4.5).
scripting, framesetOK bool
+ // The stack of template insertion modes
+ templateStack insertionModeStack
// im is the current insertion mode.
im insertionMode
// originalIM is the insertion mode to go back to after completing a text
// or inTableText insertion mode.
originalIM insertionMode
// fosterParenting is whether new elements should be inserted according to
- // the foster parenting rules (section 12.2.5.3).
+ // the foster parenting rules (section 12.2.6.1).
fosterParenting bool
// quirks is whether the parser is operating in "quirks mode."
quirks bool
@@ -56,7 +58,7 @@ func (p *parser) top() *Node {
return p.doc
}
-// Stop tags for use in popUntil. These come from section 12.2.3.2.
+// Stop tags for use in popUntil. These come from section 12.2.4.2.
var (
defaultScopeStopTags = map[string][]a.Atom{
"": {a.Applet, a.Caption, a.Html, a.Table, a.Td, a.Th, a.Marquee, a.Object, a.Template},
@@ -79,7 +81,7 @@ const (
// popUntil pops the stack of open elements at the highest element whose tag
// is in matchTags, provided there is no higher element in the scope's stop
-// tags (as defined in section 12.2.3.2). It returns whether or not there was
+// tags (as defined in section 12.2.4.2). It returns whether or not there was
// such an element. If there was not, popUntil leaves the stack unchanged.
//
// For example, the set of stop tags for table scope is: "html", "table". If
@@ -126,7 +128,7 @@ func (p *parser) indexOfElementInScope(s scope, matchTags ...a.Atom) int {
return -1
}
case tableScope:
- if tagAtom == a.Html || tagAtom == a.Table {
+ if tagAtom == a.Html || tagAtom == a.Table || tagAtom == a.Template {
return -1
}
case selectScope:
@@ -162,17 +164,17 @@ func (p *parser) clearStackToContext(s scope) {
tagAtom := p.oe[i].DataAtom
switch s {
case tableScope:
- if tagAtom == a.Html || tagAtom == a.Table {
+ if tagAtom == a.Html || tagAtom == a.Table || tagAtom == a.Template {
p.oe = p.oe[:i+1]
return
}
case tableRowScope:
- if tagAtom == a.Html || tagAtom == a.Tr {
+ if tagAtom == a.Html || tagAtom == a.Tr || tagAtom == a.Template {
p.oe = p.oe[:i+1]
return
}
case tableBodyScope:
- if tagAtom == a.Html || tagAtom == a.Tbody || tagAtom == a.Tfoot || tagAtom == a.Thead {
+ if tagAtom == a.Html || tagAtom == a.Tbody || tagAtom == a.Tfoot || tagAtom == a.Thead || tagAtom == a.Template {
p.oe = p.oe[:i+1]
return
}
@@ -183,7 +185,7 @@ func (p *parser) clearStackToContext(s scope) {
}
// generateImpliedEndTags pops nodes off the stack of open elements as long as
-// the top node has a tag name of dd, dt, li, option, optgroup, p, rp, or rt.
+// the top node has a tag name of dd, dt, li, optgroup, option, p, rb, rp, rt or rtc.
// If exceptions are specified, nodes with that name will not be popped off.
func (p *parser) generateImpliedEndTags(exceptions ...string) {
var i int
@@ -192,7 +194,7 @@ loop:
n := p.oe[i]
if n.Type == ElementNode {
switch n.DataAtom {
- case a.Dd, a.Dt, a.Li, a.Option, a.Optgroup, a.P, a.Rp, a.Rt:
+ case a.Dd, a.Dt, a.Li, a.Optgroup, a.Option, a.P, a.Rb, a.Rp, a.Rt, a.Rtc:
for _, except := range exceptions {
if n.Data == except {
break loop
@@ -234,9 +236,9 @@ func (p *parser) shouldFosterParent() bool {
}
// fosterParent adds a child node according to the foster parenting rules.
-// Section 12.2.5.3, "foster parenting".
+// Section 12.2.6.1, "foster parenting".
func (p *parser) fosterParent(n *Node) {
- var table, parent, prev *Node
+ var table, parent, prev, template *Node
var i int
for i = len(p.oe) - 1; i >= 0; i-- {
if p.oe[i].DataAtom == a.Table {
@@ -245,6 +247,19 @@ func (p *parser) fosterParent(n *Node) {
}
}
+ var j int
+ for j = len(p.oe) - 1; j >= 0; j-- {
+ if p.oe[j].DataAtom == a.Template {
+ template = p.oe[j]
+ break
+ }
+ }
+
+ if template != nil && (table == nil || j > i) {
+ template.AppendChild(n)
+ return
+ }
+
if table == nil {
// The foster parent is the html element.
parent = p.oe[0]
@@ -304,7 +319,7 @@ func (p *parser) addElement() {
})
}
-// Section 12.2.3.3.
+// Section 12.2.4.3.
func (p *parser) addFormattingElement() {
tagAtom, attr := p.tok.DataAtom, p.tok.Attr
p.addElement()
@@ -351,7 +366,7 @@ findIdenticalElements:
p.afe = append(p.afe, p.top())
}
-// Section 12.2.3.3.
+// Section 12.2.4.3.
func (p *parser) clearActiveFormattingElements() {
for {
n := p.afe.pop()
@@ -361,7 +376,7 @@ func (p *parser) clearActiveFormattingElements() {
}
}
-// Section 12.2.3.3.
+// Section 12.2.4.3.
func (p *parser) reconstructActiveFormattingElements() {
n := p.afe.top()
if n == nil {
@@ -390,12 +405,12 @@ func (p *parser) reconstructActiveFormattingElements() {
}
}
-// Section 12.2.4.
+// Section 12.2.5.
func (p *parser) acknowledgeSelfClosingTag() {
p.hasSelfClosingToken = false
}
-// An insertion mode (section 12.2.3.1) is the state transition function from
+// An insertion mode (section 12.2.4.1) is the state transition function from
// a particular state in the HTML5 parser's state machine. It updates the
// parser's fields depending on parser.tok (where ErrorToken means EOF).
// It returns whether the token was consumed.
@@ -403,7 +418,7 @@ type insertionMode func(*parser) bool
// setOriginalIM sets the insertion mode to return to after completing a text or
// inTableText insertion mode.
-// Section 12.2.3.1, "using the rules for".
+// Section 12.2.4.1, "using the rules for".
func (p *parser) setOriginalIM() {
if p.originalIM != nil {
panic("html: bad parser state: originalIM was set twice")
@@ -411,18 +426,35 @@ func (p *parser) setOriginalIM() {
p.originalIM = p.im
}
-// Section 12.2.3.1, "reset the insertion mode".
+// Section 12.2.4.1, "reset the insertion mode".
func (p *parser) resetInsertionMode() {
for i := len(p.oe) - 1; i >= 0; i-- {
n := p.oe[i]
- if i == 0 && p.context != nil {
+ last := i == 0
+ if last && p.context != nil {
n = p.context
}
switch n.DataAtom {
case a.Select:
+ if !last {
+ for ancestor, first := n, p.oe[0]; ancestor != first; {
+ ancestor = p.oe[p.oe.index(ancestor)-1]
+ switch ancestor.DataAtom {
+ case a.Template:
+ p.im = inSelectIM
+ return
+ case a.Table:
+ p.im = inSelectInTableIM
+ return
+ }
+ }
+ }
p.im = inSelectIM
case a.Td, a.Th:
+ // TODO: remove this divergence from the HTML5 spec.
+ //
+ // See https://bugs.chromium.org/p/chromium/issues/detail?id=829668
p.im = inCellIM
case a.Tr:
p.im = inRowIM
@@ -434,25 +466,41 @@ func (p *parser) resetInsertionMode() {
p.im = inColumnGroupIM
case a.Table:
p.im = inTableIM
+ case a.Template:
+ // TODO: remove this divergence from the HTML5 spec.
+ if n.Namespace != "" {
+ continue
+ }
+ p.im = p.templateStack.top()
case a.Head:
- p.im = inBodyIM
+ // TODO: remove this divergence from the HTML5 spec.
+ //
+ // See https://bugs.chromium.org/p/chromium/issues/detail?id=829668
+ p.im = inHeadIM
case a.Body:
p.im = inBodyIM
case a.Frameset:
p.im = inFramesetIM
case a.Html:
- p.im = beforeHeadIM
+ if p.head == nil {
+ p.im = beforeHeadIM
+ } else {
+ p.im = afterHeadIM
+ }
default:
+ if last {
+ p.im = inBodyIM
+ return
+ }
continue
}
return
}
- p.im = inBodyIM
}
const whitespace = " \t\r\n\f"
-// Section 12.2.5.4.1.
+// Section 12.2.6.4.1.
func initialIM(p *parser) bool {
switch p.tok.Type {
case TextToken:
@@ -479,7 +527,7 @@ func initialIM(p *parser) bool {
return false
}
-// Section 12.2.5.4.2.
+// Section 12.2.6.4.2.
func beforeHTMLIM(p *parser) bool {
switch p.tok.Type {
case DoctypeToken:
@@ -517,7 +565,7 @@ func beforeHTMLIM(p *parser) bool {
return false
}
-// Section 12.2.5.4.3.
+// Section 12.2.6.4.3.
func beforeHeadIM(p *parser) bool {
switch p.tok.Type {
case TextToken:
@@ -560,7 +608,7 @@ func beforeHeadIM(p *parser) bool {
return false
}
-// Section 12.2.5.4.4.
+// Section 12.2.6.4.4.
func inHeadIM(p *parser) bool {
switch p.tok.Type {
case TextToken:
@@ -582,7 +630,16 @@ func inHeadIM(p *parser) bool {
p.oe.pop()
p.acknowledgeSelfClosingTag()
return true
- case a.Script, a.Title, a.Noscript, a.Noframes, a.Style:
+ case a.Noscript:
+ p.addElement()
+ if p.scripting {
+ p.setOriginalIM()
+ p.im = textIM
+ } else {
+ p.im = inHeadNoscriptIM
+ }
+ return true
+ case a.Script, a.Title, a.Noframes, a.Style:
p.addElement()
p.setOriginalIM()
p.im = textIM
@@ -590,19 +647,41 @@ func inHeadIM(p *parser) bool {
case a.Head:
// Ignore the token.
return true
+ case a.Template:
+ p.addElement()
+ p.afe = append(p.afe, &scopeMarker)
+ p.framesetOK = false
+ p.im = inTemplateIM
+ p.templateStack = append(p.templateStack, inTemplateIM)
+ return true
}
case EndTagToken:
switch p.tok.DataAtom {
case a.Head:
- n := p.oe.pop()
- if n.DataAtom != a.Head {
- panic("html: bad parser state: <head> element not found, in the in-head insertion mode")
- }
+ p.oe.pop()
p.im = afterHeadIM
return true
case a.Body, a.Html, a.Br:
p.parseImpliedToken(EndTagToken, a.Head, a.Head.String())
return false
+ case a.Template:
+ if !p.oe.contains(a.Template) {
+ return true
+ }
+ // TODO: remove this divergence from the HTML5 spec.
+ //
+ // See https://bugs.chromium.org/p/chromium/issues/detail?id=829668
+ p.generateImpliedEndTags()
+ for i := len(p.oe) - 1; i >= 0; i-- {
+ if n := p.oe[i]; n.Namespace == "" && n.DataAtom == a.Template {
+ p.oe = p.oe[:i]
+ break
+ }
+ }
+ p.clearActiveFormattingElements()
+ p.templateStack.pop()
+ p.resetInsertionMode()
+ return true
default:
// Ignore the token.
return true
@@ -622,7 +701,50 @@ func inHeadIM(p *parser) bool {
return false
}
-// Section 12.2.5.4.6.
+// 12.2.6.4.5.
+func inHeadNoscriptIM(p *parser) bool {
+ switch p.tok.Type {
+ case DoctypeToken:
+ // Ignore the token.
+ return true
+ case StartTagToken:
+ switch p.tok.DataAtom {
+ case a.Html:
+ return inBodyIM(p)
+ case a.Basefont, a.Bgsound, a.Link, a.Meta, a.Noframes, a.Style:
+ return inHeadIM(p)
+ case a.Head, a.Noscript:
+ // Ignore the token.
+ return true
+ }
+ case EndTagToken:
+ switch p.tok.DataAtom {
+ case a.Noscript, a.Br:
+ default:
+ // Ignore the token.
+ return true
+ }
+ case TextToken:
+ s := strings.TrimLeft(p.tok.Data, whitespace)
+ if len(s) == 0 {
+ // It was all whitespace.
+ return inHeadIM(p)
+ }
+ case CommentToken:
+ return inHeadIM(p)
+ }
+ p.oe.pop()
+ if p.top().DataAtom != a.Head {
+ panic("html: the new current node will be a head element.")
+ }
+ p.im = inHeadIM
+ if p.tok.DataAtom == a.Noscript {
+ return true
+ }
+ return false
+}
+
+// Section 12.2.6.4.6.
func afterHeadIM(p *parser) bool {
switch p.tok.Type {
case TextToken:
@@ -648,7 +770,7 @@ func afterHeadIM(p *parser) bool {
p.addElement()
p.im = inFramesetIM
return true
- case a.Base, a.Basefont, a.Bgsound, a.Link, a.Meta, a.Noframes, a.Script, a.Style, a.Title:
+ case a.Base, a.Basefont, a.Bgsound, a.Link, a.Meta, a.Noframes, a.Script, a.Style, a.Template, a.Title:
p.oe = append(p.oe, p.head)
defer p.oe.remove(p.head)
return inHeadIM(p)
@@ -660,6 +782,8 @@ func afterHeadIM(p *parser) bool {
switch p.tok.DataAtom {
case a.Body, a.Html, a.Br:
// Drop down to creating an implied <body> tag.
+ case a.Template:
+ return inHeadIM(p)
default:
// Ignore the token.
return true
@@ -697,7 +821,7 @@ func copyAttributes(dst *Node, src Token) {
}
}
-// Section 12.2.5.4.7.
+// Section 12.2.6.4.7.
func inBodyIM(p *parser) bool {
switch p.tok.Type {
case TextToken:
@@ -727,10 +851,16 @@ func inBodyIM(p *parser) bool {
case StartTagToken:
switch p.tok.DataAtom {
case a.Html:
+ if p.oe.contains(a.Template) {
+ return true
+ }
copyAttributes(p.oe[0], p.tok)
- case a.Base, a.Basefont, a.Bgsound, a.Command, a.Link, a.Meta, a.Noframes, a.Script, a.Style, a.Title:
+ case a.Base, a.Basefont, a.Bgsound, a.Command, a.Link, a.Meta, a.Noframes, a.Script, a.Style, a.Template, a.Title:
return inHeadIM(p)
case a.Body:
+ if p.oe.contains(a.Template) {
+ return true
+ }
if len(p.oe) >= 2 {
body := p.oe[1]
if body.Type == ElementNode && body.DataAtom == a.Body {
@@ -767,9 +897,13 @@ func inBodyIM(p *parser) bool {
// The newline, if any, will be dealt with by the TextToken case.
p.framesetOK = false
case a.Form:
- if p.form == nil {
- p.popUntil(buttonScope, a.P)
- p.addElement()
+ if p.form != nil && !p.oe.contains(a.Template) {
+ // Ignore the token
+ return true
+ }
+ p.popUntil(buttonScope, a.P)
+ p.addElement()
+ if !p.oe.contains(a.Template) {
p.form = p.top()
}
case a.Li:
@@ -819,7 +953,7 @@ func inBodyIM(p *parser) bool {
case a.A:
for i := len(p.afe) - 1; i >= 0 && p.afe[i].Type != scopeMarkerNode; i-- {
if n := p.afe[i]; n.Type == ElementNode && n.DataAtom == a.A {
- p.inBodyEndTagFormatting(a.A)
+ p.inBodyEndTagFormatting(a.A, "a")
p.oe.remove(n)
p.afe.remove(n)
break
@@ -833,7 +967,7 @@ func inBodyIM(p *parser) bool {
case a.Nobr:
p.reconstructActiveFormattingElements()
if p.elementInScope(defaultScope, a.Nobr) {
- p.inBodyEndTagFormatting(a.Nobr)
+ p.inBodyEndTagFormatting(a.Nobr, "nobr")
p.reconstructActiveFormattingElements()
}
p.addFormattingElement()
@@ -903,6 +1037,14 @@ func inBodyIM(p *parser) bool {
p.acknowledgeSelfClosingTag()
p.popUntil(buttonScope, a.P)
p.parseImpliedToken(StartTagToken, a.Form, a.Form.String())
+ if p.form == nil {
+ // NOTE: The 'isindex' element has been removed,
+ // and the 'template' element has not been designed to be
+ // collaborative with the index element.
+ //
+ // Ignore the token.
+ return true
+ }
if action != "" {
p.form.Attr = []Attribute{{Key: "action", Val: action}}
}
@@ -952,11 +1094,16 @@ func inBodyIM(p *parser) bool {
}
p.reconstructActiveFormattingElements()
p.addElement()
- case a.Rp, a.Rt:
+ case a.Rb, a.Rtc:
if p.elementInScope(defaultScope, a.Ruby) {
p.generateImpliedEndTags()
}
p.addElement()
+ case a.Rp, a.Rt:
+ if p.elementInScope(defaultScope, a.Ruby) {
+ p.generateImpliedEndTags("rtc")
+ }
+ p.addElement()
case a.Math, a.Svg:
p.reconstructActiveFormattingElements()
if p.tok.DataAtom == a.Math {
@@ -993,15 +1140,29 @@ func inBodyIM(p *parser) bool {
case a.Address, a.Article, a.Aside, a.Blockquote, a.Button, a.Center, a.Details, a.Dir, a.Div, a.Dl, a.Fieldset, a.Figcaption, a.Figure, a.Footer, a.Header, a.Hgroup, a.Listing, a.Menu, a.Nav, a.Ol, a.Pre, a.Section, a.Summary, a.Ul:
p.popUntil(defaultScope, p.tok.DataAtom)
case a.Form:
- node := p.form
- p.form = nil
- i := p.indexOfElementInScope(defaultScope, a.Form)
- if node == nil || i == -1 || p.oe[i] != node {
- // Ignore the token.
- return true
+ if p.oe.contains(a.Template) {
+ i := p.indexOfElementInScope(defaultScope, a.Form)
+ if i == -1 {
+ // Ignore the token.
+ return true
+ }
+ p.generateImpliedEndTags()
+ if p.oe[i].DataAtom != a.Form {
+ // Ignore the token.
+ return true
+ }
+ p.popUntil(defaultScope, a.Form)
+ } else {
+ node := p.form
+ p.form = nil
+ i := p.indexOfElementInScope(defaultScope, a.Form)
+ if node == nil || i == -1 || p.oe[i] != node {
+ // Ignore the token.
+ return true
+ }
+ p.generateImpliedEndTags()
+ p.oe.remove(node)
}
- p.generateImpliedEndTags()
- p.oe.remove(node)
case a.P:
if !p.elementInScope(buttonScope, a.P) {
p.parseImpliedToken(StartTagToken, a.P, a.P.String())
@@ -1014,7 +1175,7 @@ func inBodyIM(p *parser) bool {
case a.H1, a.H2, a.H3, a.H4, a.H5, a.H6:
p.popUntil(defaultScope, a.H1, a.H2, a.H3, a.H4, a.H5, a.H6)
case a.A, a.B, a.Big, a.Code, a.Em, a.Font, a.I, a.Nobr, a.S, a.Small, a.Strike, a.Strong, a.Tt, a.U:
- p.inBodyEndTagFormatting(p.tok.DataAtom)
+ p.inBodyEndTagFormatting(p.tok.DataAtom, p.tok.Data)
case a.Applet, a.Marquee, a.Object:
if p.popUntil(defaultScope, p.tok.DataAtom) {
p.clearActiveFormattingElements()
@@ -1022,20 +1183,37 @@ func inBodyIM(p *parser) bool {
case a.Br:
p.tok.Type = StartTagToken
return false
+ case a.Template:
+ return inHeadIM(p)
default:
- p.inBodyEndTagOther(p.tok.DataAtom)
+ p.inBodyEndTagOther(p.tok.DataAtom, p.tok.Data)
}
case CommentToken:
p.addChild(&Node{
Type: CommentNode,
Data: p.tok.Data,
})
+ case ErrorToken:
+ // TODO: remove this divergence from the HTML5 spec.
+ if len(p.templateStack) > 0 {
+ p.im = inTemplateIM
+ return false
+ } else {
+ for _, e := range p.oe {
+ switch e.DataAtom {
+ case a.Dd, a.Dt, a.Li, a.Optgroup, a.Option, a.P, a.Rb, a.Rp, a.Rt, a.Rtc, a.Tbody, a.Td, a.Tfoot, a.Th,
+ a.Thead, a.Tr, a.Body, a.Html:
+ default:
+ return true
+ }
+ }
+ }
}
return true
}
-func (p *parser) inBodyEndTagFormatting(tagAtom a.Atom) {
+func (p *parser) inBodyEndTagFormatting(tagAtom a.Atom, tagName string) {
// This is the "adoption agency" algorithm, described at
// https://html.spec.whatwg.org/multipage/syntax.html#adoptionAgency
@@ -1057,7 +1235,7 @@ func (p *parser) inBodyEndTagFormatting(tagAtom a.Atom) {
}
}
if formattingElement == nil {
- p.inBodyEndTagOther(tagAtom)
+ p.inBodyEndTagOther(tagAtom, tagName)
return
}
feIndex := p.oe.index(formattingElement)
@@ -1160,11 +1338,19 @@ func (p *parser) inBodyEndTagFormatting(tagAtom a.Atom) {
}
// inBodyEndTagOther performs the "any other end tag" algorithm for inBodyIM.
-// "Any other end tag" handling from 12.2.5.5 The rules for parsing tokens in foreign content
+// "Any other end tag" handling from 12.2.6.5 The rules for parsing tokens in foreign content
// https://html.spec.whatwg.org/multipage/syntax.html#parsing-main-inforeign
-func (p *parser) inBodyEndTagOther(tagAtom a.Atom) {
+func (p *parser) inBodyEndTagOther(tagAtom a.Atom, tagName string) {
for i := len(p.oe) - 1; i >= 0; i-- {
- if p.oe[i].DataAtom == tagAtom {
+ // Two element nodes have the same tag if they have the same Data (a
+ // string-typed field). As an optimization, for common HTML tags, each
+ // Data string is assigned a unique, non-zero DataAtom (a uint32-typed
+ // field), since integer comparison is faster than string comparison.
+ // Uncommon (custom) tags get a zero DataAtom.
+ //
+ // The if condition here is equivalent to (p.oe[i].Data == tagName).
+ if (p.oe[i].DataAtom == tagAtom) &&
+ ((tagAtom != 0) || (p.oe[i].Data == tagName)) {
p.oe = p.oe[:i]
break
}
@@ -1174,7 +1360,7 @@ func (p *parser) inBodyEndTagOther(tagAtom a.Atom) {
}
}
-// Section 12.2.5.4.8.
+// Section 12.2.6.4.8.
func textIM(p *parser) bool {
switch p.tok.Type {
case ErrorToken:
@@ -1203,12 +1389,9 @@ func textIM(p *parser) bool {
return p.tok.Type == EndTagToken
}
-// Section 12.2.5.4.9.
+// Section 12.2.6.4.9.
func inTableIM(p *parser) bool {
switch p.tok.Type {
- case ErrorToken:
- // Stop parsing.
- return true
case TextToken:
p.tok.Data = strings.Replace(p.tok.Data, "\x00", "", -1)
switch p.oe.top().DataAtom {
@@ -1249,7 +1432,7 @@ func inTableIM(p *parser) bool {
}
// Ignore the token.
return true
- case a.Style, a.Script:
+ case a.Style, a.Script, a.Template:
return inHeadIM(p)
case a.Input:
for _, t := range p.tok.Attr {
@@ -1261,7 +1444,7 @@ func inTableIM(p *parser) bool {
}
// Otherwise drop down to the default action.
case a.Form:
- if p.form != nil {
+ if p.oe.contains(a.Template) || p.form != nil {
// Ignore the token.
return true
}
@@ -1291,6 +1474,8 @@ func inTableIM(p *parser) bool {
case a.Body, a.Caption, a.Col, a.Colgroup, a.Html, a.Tbody, a.Td, a.Tfoot, a.Th, a.Thead, a.Tr:
// Ignore the token.
return true
+ case a.Template:
+ return inHeadIM(p)
}
case CommentToken:
p.addChild(&Node{
@@ -1301,6 +1486,8 @@ func inTableIM(p *parser) bool {
case DoctypeToken:
// Ignore the token.
return true
+ case ErrorToken:
+ return inBodyIM(p)
}
p.fosterParenting = true
@@ -1309,7 +1496,7 @@ func inTableIM(p *parser) bool {
return inBodyIM(p)
}
-// Section 12.2.5.4.11.
+// Section 12.2.6.4.11.
func inCaptionIM(p *parser) bool {
switch p.tok.Type {
case StartTagToken:
@@ -1355,7 +1542,7 @@ func inCaptionIM(p *parser) bool {
return inBodyIM(p)
}
-// Section 12.2.5.4.12.
+// Section 12.2.6.4.12.
func inColumnGroupIM(p *parser) bool {
switch p.tok.Type {
case TextToken:
@@ -1386,11 +1573,13 @@ func inColumnGroupIM(p *parser) bool {
p.oe.pop()
p.acknowledgeSelfClosingTag()
return true
+ case a.Template:
+ return inHeadIM(p)
}
case EndTagToken:
switch p.tok.DataAtom {
case a.Colgroup:
- if p.oe.top().DataAtom != a.Html {
+ if p.oe.top().DataAtom == a.Colgroup {
p.oe.pop()
p.im = inTableIM
}
@@ -1398,17 +1587,21 @@ func inColumnGroupIM(p *parser) bool {
case a.Col:
// Ignore the token.
return true
+ case a.Template:
+ return inHeadIM(p)
}
+ case ErrorToken:
+ return inBodyIM(p)
}
- if p.oe.top().DataAtom != a.Html {
- p.oe.pop()
- p.im = inTableIM
- return false
+ if p.oe.top().DataAtom != a.Colgroup {
+ return true
}
- return true
+ p.oe.pop()
+ p.im = inTableIM
+ return false
}
-// Section 12.2.5.4.13.
+// Section 12.2.6.4.13.
func inTableBodyIM(p *parser) bool {
switch p.tok.Type {
case StartTagToken:
@@ -1460,7 +1653,7 @@ func inTableBodyIM(p *parser) bool {
return inTableIM(p)
}
-// Section 12.2.5.4.14.
+// Section 12.2.6.4.14.
func inRowIM(p *parser) bool {
switch p.tok.Type {
case StartTagToken:
@@ -1511,7 +1704,7 @@ func inRowIM(p *parser) bool {
return inTableIM(p)
}
-// Section 12.2.5.4.15.
+// Section 12.2.6.4.15.
func inCellIM(p *parser) bool {
switch p.tok.Type {
case StartTagToken:
@@ -1551,8 +1744,9 @@ func inCellIM(p *parser) bool {
return true
}
// Close the cell and reprocess.
- p.popUntil(tableScope, a.Td, a.Th)
- p.clearActiveFormattingElements()
+ if p.popUntil(tableScope, a.Td, a.Th) {
+ p.clearActiveFormattingElements()
+ }
p.im = inRowIM
return false
}
@@ -1560,12 +1754,9 @@ func inCellIM(p *parser) bool {
return inBodyIM(p)
}
-// Section 12.2.5.4.16.
+// Section 12.2.6.4.16.
func inSelectIM(p *parser) bool {
switch p.tok.Type {
- case ErrorToken:
- // Stop parsing.
- return true
case TextToken:
p.addText(strings.Replace(p.tok.Data, "\x00", "", -1))
case StartTagToken:
@@ -1586,8 +1777,12 @@ func inSelectIM(p *parser) bool {
}
p.addElement()
case a.Select:
- p.tok.Type = EndTagToken
- return false
+ if p.popUntil(selectScope, a.Select) {
+ p.resetInsertionMode()
+ } else {
+ // Ignore the token.
+ return true
+ }
case a.Input, a.Keygen, a.Textarea:
if p.elementInScope(selectScope, a.Select) {
p.parseImpliedToken(EndTagToken, a.Select, a.Select.String())
@@ -1597,7 +1792,7 @@ func inSelectIM(p *parser) bool {
p.tokenizer.NextIsNotRawText()
// Ignore the token.
return true
- case a.Script:
+ case a.Script, a.Template:
return inHeadIM(p)
}
case EndTagToken:
@@ -1617,7 +1812,12 @@ func inSelectIM(p *parser) bool {
case a.Select:
if p.popUntil(selectScope, a.Select) {
p.resetInsertionMode()
+ } else {
+ // Ignore the token.
+ return true
}
+ case a.Template:
+ return inHeadIM(p)
}
case CommentToken:
p.addChild(&Node{
@@ -1627,30 +1827,107 @@ func inSelectIM(p *parser) bool {
case DoctypeToken:
// Ignore the token.
return true
+ case ErrorToken:
+ return inBodyIM(p)
}
return true
}
-// Section 12.2.5.4.17.
+// Section 12.2.6.4.17.
func inSelectInTableIM(p *parser) bool {
switch p.tok.Type {
case StartTagToken, EndTagToken:
switch p.tok.DataAtom {
case a.Caption, a.Table, a.Tbody, a.Tfoot, a.Thead, a.Tr, a.Td, a.Th:
- if p.tok.Type == StartTagToken || p.elementInScope(tableScope, p.tok.DataAtom) {
- p.parseImpliedToken(EndTagToken, a.Select, a.Select.String())
- return false
- } else {
+ if p.tok.Type == EndTagToken && !p.elementInScope(tableScope, p.tok.DataAtom) {
// Ignore the token.
return true
}
+ // This is like p.popUntil(selectScope, a.Select), but it also
+ // matches <math select>, not just <select>. Matching the MathML
+ // tag is arguably incorrect (conceptually), but it mimics what
+ // Chromium does.
+ for i := len(p.oe) - 1; i >= 0; i-- {
+ if n := p.oe[i]; n.DataAtom == a.Select {
+ p.oe = p.oe[:i]
+ break
+ }
+ }
+ p.resetInsertionMode()
+ return false
}
}
return inSelectIM(p)
}
-// Section 12.2.5.4.18.
+// Section 12.2.6.4.18.
+func inTemplateIM(p *parser) bool {
+ switch p.tok.Type {
+ case TextToken, CommentToken, DoctypeToken:
+ return inBodyIM(p)
+ case StartTagToken:
+ switch p.tok.DataAtom {
+ case a.Base, a.Basefont, a.Bgsound, a.Link, a.Meta, a.Noframes, a.Script, a.Style, a.Template, a.Title:
+ return inHeadIM(p)
+ case a.Caption, a.Colgroup, a.Tbody, a.Tfoot, a.Thead:
+ p.templateStack.pop()
+ p.templateStack = append(p.templateStack, inTableIM)
+ p.im = inTableIM
+ return false
+ case a.Col:
+ p.templateStack.pop()
+ p.templateStack = append(p.templateStack, inColumnGroupIM)
+ p.im = inColumnGroupIM
+ return false
+ case a.Tr:
+ p.templateStack.pop()
+ p.templateStack = append(p.templateStack, inTableBodyIM)
+ p.im = inTableBodyIM
+ return false
+ case a.Td, a.Th:
+ p.templateStack.pop()
+ p.templateStack = append(p.templateStack, inRowIM)
+ p.im = inRowIM
+ return false
+ default:
+ p.templateStack.pop()
+ p.templateStack = append(p.templateStack, inBodyIM)
+ p.im = inBodyIM
+ return false
+ }
+ case EndTagToken:
+ switch p.tok.DataAtom {
+ case a.Template:
+ return inHeadIM(p)
+ default:
+ // Ignore the token.
+ return true
+ }
+ case ErrorToken:
+ if !p.oe.contains(a.Template) {
+ // Ignore the token.
+ return true
+ }
+ // TODO: remove this divergence from the HTML5 spec.
+ //
+ // See https://bugs.chromium.org/p/chromium/issues/detail?id=829668
+ p.generateImpliedEndTags()
+ for i := len(p.oe) - 1; i >= 0; i-- {
+ if n := p.oe[i]; n.Namespace == "" && n.DataAtom == a.Template {
+ p.oe = p.oe[:i]
+ break
+ }
+ }
+ p.clearActiveFormattingElements()
+ p.templateStack.pop()
+ p.resetInsertionMode()
+ return false
+ }
+ return false
+}
+
+// Section 12.2.6.4.19.
func afterBodyIM(p *parser) bool {
switch p.tok.Type {
case ErrorToken:
@@ -1688,7 +1965,7 @@ func afterBodyIM(p *parser) bool {
return false
}
-// Section 12.2.5.4.19.
+// Section 12.2.6.4.20.
func inFramesetIM(p *parser) bool {
switch p.tok.Type {
case CommentToken:
@@ -1738,7 +2015,7 @@ func inFramesetIM(p *parser) bool {
return true
}
-// Section 12.2.5.4.20.
+// Section 12.2.6.4.21.
func afterFramesetIM(p *parser) bool {
switch p.tok.Type {
case CommentToken:
@@ -1777,7 +2054,7 @@ func afterFramesetIM(p *parser) bool {
return true
}
-// Section 12.2.5.4.21.
+// Section 12.2.6.4.22.
func afterAfterBodyIM(p *parser) bool {
switch p.tok.Type {
case ErrorToken:
@@ -1806,7 +2083,7 @@ func afterAfterBodyIM(p *parser) bool {
return false
}
-// Section 12.2.5.4.22.
+// Section 12.2.6.4.23.
func afterAfterFramesetIM(p *parser) bool {
switch p.tok.Type {
case CommentToken:
@@ -1844,7 +2121,7 @@ func afterAfterFramesetIM(p *parser) bool {
const whitespaceOrNUL = whitespace + "\x00"
-// Section 12.2.5.5.
+// Section 12.2.6.5
func parseForeignContent(p *parser) bool {
switch p.tok.Type {
case TextToken:
@@ -1924,7 +2201,7 @@ func parseForeignContent(p *parser) bool {
return true
}
-// Section 12.2.5.
+// Section 12.2.6.
func (p *parser) inForeignContent() bool {
if len(p.oe) == 0 {
return false
@@ -2012,8 +2289,44 @@ func (p *parser) parse() error {
}
// Parse returns the parse tree for the HTML from the given Reader.
+//
+// It implements the HTML5 parsing algorithm
+// (https://html.spec.whatwg.org/multipage/syntax.html#tree-construction),
+// which is very complicated. The resultant tree can contain implicitly created
+// nodes that have no explicit <tag> listed in r's data, and nodes' parents can
+// differ from the nesting implied by a naive processing of start and end
+// <tag>s. Conversely, explicit <tag>s in r's data can be silently dropped,
+// with no corresponding node in the resulting tree.
+//
// The input is assumed to be UTF-8 encoded.
func Parse(r io.Reader) (*Node, error) {
+ return ParseWithOptions(r)
+}
+
+// ParseFragment parses a fragment of HTML and returns the nodes that were
+// found. If the fragment is the InnerHTML for an existing element, pass that
+// element in context.
+//
+// It has the same intricacies as Parse.
+func ParseFragment(r io.Reader, context *Node) ([]*Node, error) {
+ return ParseFragmentWithOptions(r, context)
+}
+
+// ParseOption configures a parser.
+type ParseOption func(p *parser)
+
+// ParseOptionEnableScripting configures the scripting flag.
+// https://html.spec.whatwg.org/multipage/webappapis.html#enabling-and-disabling-scripting
+//
+// By default, scripting is enabled.
+func ParseOptionEnableScripting(enable bool) ParseOption {
+ return func(p *parser) {
+ p.scripting = enable
+ }
+}
+
+// ParseWithOptions is like Parse, with options.
+func ParseWithOptions(r io.Reader, opts ...ParseOption) (*Node, error) {
p := &parser{
tokenizer: NewTokenizer(r),
doc: &Node{
@@ -2023,6 +2336,11 @@ func Parse(r io.Reader) (*Node, error) {
framesetOK: true,
im: initialIM,
}
+
+ for _, f := range opts {
+ f(p)
+ }
+
err := p.parse()
if err != nil {
return nil, err
@@ -2030,10 +2348,8 @@ func Parse(r io.Reader) (*Node, error) {
return p.doc, nil
}
-// ParseFragment parses a fragment of HTML and returns the nodes that were
-// found. If the fragment is the InnerHTML for an existing element, pass that
-// element in context.
-func ParseFragment(r io.Reader, context *Node) ([]*Node, error) {
+// ParseFragmentWithOptions is like ParseFragment, with options.
+func ParseFragmentWithOptions(r io.Reader, context *Node, opts ...ParseOption) ([]*Node, error) {
contextTag := ""
if context != nil {
if context.Type != ElementNode {
@@ -2057,6 +2373,10 @@ func ParseFragment(r io.Reader, context *Node) ([]*Node, error) {
context: context,
}
+ for _, f := range opts {
+ f(p)
+ }
+
root := &Node{
Type: ElementNode,
DataAtom: a.Html,
@@ -2064,6 +2384,9 @@ func ParseFragment(r io.Reader, context *Node) ([]*Node, error) {
}
p.doc.AppendChild(root)
p.oe = nodeStack{root}
+ if context != nil && context.DataAtom == a.Template {
+ p.templateStack = append(p.templateStack, inTemplateIM)
+ }
p.resetInsertionMode()
for n := context; n != nil; n = n.Parent {
diff --git a/vendor/golang.org/x/text/encoding/charmap/maketables.go b/vendor/golang.org/x/text/encoding/charmap/maketables.go
deleted file mode 100644
index f794170..0000000
--- a/vendor/golang.org/x/text/encoding/charmap/maketables.go
+++ /dev/null
@@ -1,556 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-import (
- "bufio"
- "fmt"
- "log"
- "net/http"
- "sort"
- "strings"
- "unicode/utf8"
-
- "golang.org/x/text/encoding"
- "golang.org/x/text/internal/gen"
-)
-
-const ascii = "\x00\x01\x02\x03\x04\x05\x06\x07\x08\x09\x0a\x0b\x0c\x0d\x0e\x0f" +
- "\x10\x11\x12\x13\x14\x15\x16\x17\x18\x19\x1a\x1b\x1c\x1d\x1e\x1f" +
- ` !"#$%&'()*+,-./0123456789:;<=>?` +
- `@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_` +
- "`abcdefghijklmnopqrstuvwxyz{|}~\u007f"
-
-var encodings = []struct {
- name string
- mib string
- comment string
- varName string
- replacement byte
- mapping string
-}{
- {
- "IBM Code Page 037",
- "IBM037",
- "",
- "CodePage037",
- 0x3f,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/glibc-IBM037-2.1.2.ucm",
- },
- {
- "IBM Code Page 437",
- "PC8CodePage437",
- "",
- "CodePage437",
- encoding.ASCIISub,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/glibc-IBM437-2.1.2.ucm",
- },
- {
- "IBM Code Page 850",
- "PC850Multilingual",
- "",
- "CodePage850",
- encoding.ASCIISub,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/glibc-IBM850-2.1.2.ucm",
- },
- {
- "IBM Code Page 852",
- "PCp852",
- "",
- "CodePage852",
- encoding.ASCIISub,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/glibc-IBM852-2.1.2.ucm",
- },
- {
- "IBM Code Page 855",
- "IBM855",
- "",
- "CodePage855",
- encoding.ASCIISub,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/glibc-IBM855-2.1.2.ucm",
- },
- {
- "Windows Code Page 858", // PC latin1 with Euro
- "IBM00858",
- "",
- "CodePage858",
- encoding.ASCIISub,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/windows-858-2000.ucm",
- },
- {
- "IBM Code Page 860",
- "IBM860",
- "",
- "CodePage860",
- encoding.ASCIISub,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/glibc-IBM860-2.1.2.ucm",
- },
- {
- "IBM Code Page 862",
- "PC862LatinHebrew",
- "",
- "CodePage862",
- encoding.ASCIISub,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/glibc-IBM862-2.1.2.ucm",
- },
- {
- "IBM Code Page 863",
- "IBM863",
- "",
- "CodePage863",
- encoding.ASCIISub,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/glibc-IBM863-2.1.2.ucm",
- },
- {
- "IBM Code Page 865",
- "IBM865",
- "",
- "CodePage865",
- encoding.ASCIISub,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/glibc-IBM865-2.1.2.ucm",
- },
- {
- "IBM Code Page 866",
- "IBM866",
- "",
- "CodePage866",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-ibm866.txt",
- },
- {
- "IBM Code Page 1047",
- "IBM1047",
- "",
- "CodePage1047",
- 0x3f,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/glibc-IBM1047-2.1.2.ucm",
- },
- {
- "IBM Code Page 1140",
- "IBM01140",
- "",
- "CodePage1140",
- 0x3f,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/ibm-1140_P100-1997.ucm",
- },
- {
- "ISO 8859-1",
- "ISOLatin1",
- "",
- "ISO8859_1",
- encoding.ASCIISub,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/iso-8859_1-1998.ucm",
- },
- {
- "ISO 8859-2",
- "ISOLatin2",
- "",
- "ISO8859_2",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-iso-8859-2.txt",
- },
- {
- "ISO 8859-3",
- "ISOLatin3",
- "",
- "ISO8859_3",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-iso-8859-3.txt",
- },
- {
- "ISO 8859-4",
- "ISOLatin4",
- "",
- "ISO8859_4",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-iso-8859-4.txt",
- },
- {
- "ISO 8859-5",
- "ISOLatinCyrillic",
- "",
- "ISO8859_5",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-iso-8859-5.txt",
- },
- {
- "ISO 8859-6",
- "ISOLatinArabic",
- "",
- "ISO8859_6,ISO8859_6E,ISO8859_6I",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-iso-8859-6.txt",
- },
- {
- "ISO 8859-7",
- "ISOLatinGreek",
- "",
- "ISO8859_7",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-iso-8859-7.txt",
- },
- {
- "ISO 8859-8",
- "ISOLatinHebrew",
- "",
- "ISO8859_8,ISO8859_8E,ISO8859_8I",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-iso-8859-8.txt",
- },
- {
- "ISO 8859-9",
- "ISOLatin5",
- "",
- "ISO8859_9",
- encoding.ASCIISub,
- "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/iso-8859_9-1999.ucm",
- },
- {
- "ISO 8859-10",
- "ISOLatin6",
- "",
- "ISO8859_10",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-iso-8859-10.txt",
- },
- {
- "ISO 8859-13",
- "ISO885913",
- "",
- "ISO8859_13",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-iso-8859-13.txt",
- },
- {
- "ISO 8859-14",
- "ISO885914",
- "",
- "ISO8859_14",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-iso-8859-14.txt",
- },
- {
- "ISO 8859-15",
- "ISO885915",
- "",
- "ISO8859_15",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-iso-8859-15.txt",
- },
- {
- "ISO 8859-16",
- "ISO885916",
- "",
- "ISO8859_16",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-iso-8859-16.txt",
- },
- {
- "KOI8-R",
- "KOI8R",
- "",
- "KOI8R",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-koi8-r.txt",
- },
- {
- "KOI8-U",
- "KOI8U",
- "",
- "KOI8U",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-koi8-u.txt",
- },
- {
- "Macintosh",
- "Macintosh",
- "",
- "Macintosh",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-macintosh.txt",
- },
- {
- "Macintosh Cyrillic",
- "MacintoshCyrillic",
- "",
- "MacintoshCyrillic",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-x-mac-cyrillic.txt",
- },
- {
- "Windows 874",
- "Windows874",
- "",
- "Windows874",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-windows-874.txt",
- },
- {
- "Windows 1250",
- "Windows1250",
- "",
- "Windows1250",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-windows-1250.txt",
- },
- {
- "Windows 1251",
- "Windows1251",
- "",
- "Windows1251",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-windows-1251.txt",
- },
- {
- "Windows 1252",
- "Windows1252",
- "",
- "Windows1252",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-windows-1252.txt",
- },
- {
- "Windows 1253",
- "Windows1253",
- "",
- "Windows1253",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-windows-1253.txt",
- },
- {
- "Windows 1254",
- "Windows1254",
- "",
- "Windows1254",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-windows-1254.txt",
- },
- {
- "Windows 1255",
- "Windows1255",
- "",
- "Windows1255",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-windows-1255.txt",
- },
- {
- "Windows 1256",
- "Windows1256",
- "",
- "Windows1256",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-windows-1256.txt",
- },
- {
- "Windows 1257",
- "Windows1257",
- "",
- "Windows1257",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-windows-1257.txt",
- },
- {
- "Windows 1258",
- "Windows1258",
- "",
- "Windows1258",
- encoding.ASCIISub,
- "http://encoding.spec.whatwg.org/index-windows-1258.txt",
- },
- {
- "X-User-Defined",
- "XUserDefined",
- "It is defined at http://encoding.spec.whatwg.org/#x-user-defined",
- "XUserDefined",
- encoding.ASCIISub,
- ascii +
- "\uf780\uf781\uf782\uf783\uf784\uf785\uf786\uf787" +
- "\uf788\uf789\uf78a\uf78b\uf78c\uf78d\uf78e\uf78f" +
- "\uf790\uf791\uf792\uf793\uf794\uf795\uf796\uf797" +
- "\uf798\uf799\uf79a\uf79b\uf79c\uf79d\uf79e\uf79f" +
- "\uf7a0\uf7a1\uf7a2\uf7a3\uf7a4\uf7a5\uf7a6\uf7a7" +
- "\uf7a8\uf7a9\uf7aa\uf7ab\uf7ac\uf7ad\uf7ae\uf7af" +
- "\uf7b0\uf7b1\uf7b2\uf7b3\uf7b4\uf7b5\uf7b6\uf7b7" +
- "\uf7b8\uf7b9\uf7ba\uf7bb\uf7bc\uf7bd\uf7be\uf7bf" +
- "\uf7c0\uf7c1\uf7c2\uf7c3\uf7c4\uf7c5\uf7c6\uf7c7" +
- "\uf7c8\uf7c9\uf7ca\uf7cb\uf7cc\uf7cd\uf7ce\uf7cf" +
- "\uf7d0\uf7d1\uf7d2\uf7d3\uf7d4\uf7d5\uf7d6\uf7d7" +
- "\uf7d8\uf7d9\uf7da\uf7db\uf7dc\uf7dd\uf7de\uf7df" +
- "\uf7e0\uf7e1\uf7e2\uf7e3\uf7e4\uf7e5\uf7e6\uf7e7" +
- "\uf7e8\uf7e9\uf7ea\uf7eb\uf7ec\uf7ed\uf7ee\uf7ef" +
- "\uf7f0\uf7f1\uf7f2\uf7f3\uf7f4\uf7f5\uf7f6\uf7f7" +
- "\uf7f8\uf7f9\uf7fa\uf7fb\uf7fc\uf7fd\uf7fe\uf7ff",
- },
-}
-
-func getWHATWG(url string) string {
- res, err := http.Get(url)
- if err != nil {
- log.Fatalf("%q: Get: %v", url, err)
- }
- defer res.Body.Close()
-
- mapping := make([]rune, 128)
- for i := range mapping {
- mapping[i] = '\ufffd'
- }
-
- scanner := bufio.NewScanner(res.Body)
- for scanner.Scan() {
- s := strings.TrimSpace(scanner.Text())
- if s == "" || s[0] == '#' {
- continue
- }
- x, y := 0, 0
- if _, err := fmt.Sscanf(s, "%d\t0x%x", &x, &y); err != nil {
- log.Fatalf("could not parse %q", s)
- }
- if x < 0 || 128 <= x {
- log.Fatalf("code %d is out of range", x)
- }
- if 0x80 <= y && y < 0xa0 {
- // We diverge from the WHATWG spec by mapping control characters
- // in the range [0x80, 0xa0) to U+FFFD.
- continue
- }
- mapping[x] = rune(y)
- }
- return ascii + string(mapping)
-}
-
-func getUCM(url string) string {
- res, err := http.Get(url)
- if err != nil {
- log.Fatalf("%q: Get: %v", url, err)
- }
- defer res.Body.Close()
-
- mapping := make([]rune, 256)
- for i := range mapping {
- mapping[i] = '\ufffd'
- }
-
- charsFound := 0
- scanner := bufio.NewScanner(res.Body)
- for scanner.Scan() {
- s := strings.TrimSpace(scanner.Text())
- if s == "" || s[0] == '#' {
- continue
- }
- var c byte
- var r rune
- if _, err := fmt.Sscanf(s, `<U%x> \x%x |0`, &r, &c); err != nil {
- continue
- }
- mapping[c] = r
- charsFound++
- }
-
- if charsFound < 200 {
- log.Fatalf("%q: only %d characters found (wrong page format?)", url, charsFound)
- }
-
- return string(mapping)
-}
-
-func main() {
- mibs := map[string]bool{}
- all := []string{}
-
- w := gen.NewCodeWriter()
- defer w.WriteGoFile("tables.go", "charmap")
-
- printf := func(s string, a ...interface{}) { fmt.Fprintf(w, s, a...) }
-
- printf("import (\n")
- printf("\t\"golang.org/x/text/encoding\"\n")
- printf("\t\"golang.org/x/text/encoding/internal/identifier\"\n")
- printf(")\n\n")
- for _, e := range encodings {
- varNames := strings.Split(e.varName, ",")
- all = append(all, varNames...)
- varName := varNames[0]
- switch {
- case strings.HasPrefix(e.mapping, "http://encoding.spec.whatwg.org/"):
- e.mapping = getWHATWG(e.mapping)
- case strings.HasPrefix(e.mapping, "http://source.icu-project.org/repos/icu/data/trunk/charset/data/ucm/"):
- e.mapping = getUCM(e.mapping)
- }
-
- asciiSuperset, low := strings.HasPrefix(e.mapping, ascii), 0x00
- if asciiSuperset {
- low = 0x80
- }
- lvn := 1
- if strings.HasPrefix(varName, "ISO") || strings.HasPrefix(varName, "KOI") {
- lvn = 3
- }
- lowerVarName := strings.ToLower(varName[:lvn]) + varName[lvn:]
- printf("// %s is the %s encoding.\n", varName, e.name)
- if e.comment != "" {
- printf("//\n// %s\n", e.comment)
- }
- printf("var %s *Charmap = &%s\n\nvar %s = Charmap{\nname: %q,\n",
- varName, lowerVarName, lowerVarName, e.name)
- if mibs[e.mib] {
- log.Fatalf("MIB type %q declared multiple times.", e.mib)
- }
- printf("mib: identifier.%s,\n", e.mib)
- printf("asciiSuperset: %t,\n", asciiSuperset)
- printf("low: 0x%02x,\n", low)
- printf("replacement: 0x%02x,\n", e.replacement)
-
- printf("decode: [256]utf8Enc{\n")
- i, backMapping := 0, map[rune]byte{}
- for _, c := range e.mapping {
- if _, ok := backMapping[c]; !ok && c != utf8.RuneError {
- backMapping[c] = byte(i)
- }
- var buf [8]byte
- n := utf8.EncodeRune(buf[:], c)
- if n > 3 {
- panic(fmt.Sprintf("rune %q (%U) is too long", c, c))
- }
- printf("{%d,[3]byte{0x%02x,0x%02x,0x%02x}},", n, buf[0], buf[1], buf[2])
- if i%2 == 1 {
- printf("\n")
- }
- i++
- }
- printf("},\n")
-
- printf("encode: [256]uint32{\n")
- encode := make([]uint32, 0, 256)
- for c, i := range backMapping {
- encode = append(encode, uint32(i)<<24|uint32(c))
- }
- sort.Sort(byRune(encode))
- for len(encode) < cap(encode) {
- encode = append(encode, encode[len(encode)-1])
- }
- for i, enc := range encode {
- printf("0x%08x,", enc)
- if i%8 == 7 {
- printf("\n")
- }
- }
- printf("},\n}\n")
-
- // Add an estimate of the size of a single Charmap{} struct value, which
- // includes two 256 elem arrays of 4 bytes and some extra fields, which
- // align to 3 uint64s on 64-bit architectures.
- w.Size += 2*4*256 + 3*8
- }
- // TODO: add proper line breaking.
- printf("var listAll = []encoding.Encoding{\n%s,\n}\n\n", strings.Join(all, ",\n"))
-}
-
-type byRune []uint32
-
-func (b byRune) Len() int { return len(b) }
-func (b byRune) Less(i, j int) bool { return b[i]&0xffffff < b[j]&0xffffff }
-func (b byRune) Swap(i, j int) { b[i], b[j] = b[j], b[i] }
diff --git a/vendor/golang.org/x/text/encoding/encoding.go b/vendor/golang.org/x/text/encoding/encoding.go
index 221f175..a0bd7cd 100644
--- a/vendor/golang.org/x/text/encoding/encoding.go
+++ b/vendor/golang.org/x/text/encoding/encoding.go
@@ -124,7 +124,7 @@ func (e *Encoder) Writer(w io.Writer) io.Writer {
}
// ASCIISub is the ASCII substitute character, as recommended by
-// http://unicode.org/reports/tr36/#Text_Comparison
+// https://unicode.org/reports/tr36/#Text_Comparison
const ASCIISub = '\x1a'
// Nop is the nop encoding. Its transformed bytes are the same as the source
diff --git a/vendor/golang.org/x/text/encoding/htmlindex/gen.go b/vendor/golang.org/x/text/encoding/htmlindex/gen.go
deleted file mode 100644
index ac6b4a7..0000000
--- a/vendor/golang.org/x/text/encoding/htmlindex/gen.go
+++ /dev/null
@@ -1,173 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-import (
- "bytes"
- "encoding/json"
- "fmt"
- "log"
- "strings"
-
- "golang.org/x/text/internal/gen"
-)
-
-type group struct {
- Encodings []struct {
- Labels []string
- Name string
- }
-}
-
-func main() {
- gen.Init()
-
- r := gen.Open("https://encoding.spec.whatwg.org", "whatwg", "encodings.json")
- var groups []group
- if err := json.NewDecoder(r).Decode(&groups); err != nil {
- log.Fatalf("Error reading encodings.json: %v", err)
- }
-
- w := &bytes.Buffer{}
- fmt.Fprintln(w, "type htmlEncoding byte")
- fmt.Fprintln(w, "const (")
- for i, g := range groups {
- for _, e := range g.Encodings {
- key := strings.ToLower(e.Name)
- name := consts[key]
- if name == "" {
- log.Fatalf("No const defined for %s.", key)
- }
- if i == 0 {
- fmt.Fprintf(w, "%s htmlEncoding = iota\n", name)
- } else {
- fmt.Fprintf(w, "%s\n", name)
- }
- }
- }
- fmt.Fprintln(w, "numEncodings")
- fmt.Fprint(w, ")\n\n")
-
- fmt.Fprintln(w, "var canonical = [numEncodings]string{")
- for _, g := range groups {
- for _, e := range g.Encodings {
- fmt.Fprintf(w, "%q,\n", strings.ToLower(e.Name))
- }
- }
- fmt.Fprint(w, "}\n\n")
-
- fmt.Fprintln(w, "var nameMap = map[string]htmlEncoding{")
- for _, g := range groups {
- for _, e := range g.Encodings {
- for _, l := range e.Labels {
- key := strings.ToLower(e.Name)
- name := consts[key]
- fmt.Fprintf(w, "%q: %s,\n", l, name)
- }
- }
- }
- fmt.Fprint(w, "}\n\n")
-
- var tags []string
- fmt.Fprintln(w, "var localeMap = []htmlEncoding{")
- for _, loc := range locales {
- tags = append(tags, loc.tag)
- fmt.Fprintf(w, "%s, // %s \n", consts[loc.name], loc.tag)
- }
- fmt.Fprint(w, "}\n\n")
-
- fmt.Fprintf(w, "const locales = %q\n", strings.Join(tags, " "))
-
- gen.WriteGoFile("tables.go", "htmlindex", w.Bytes())
-}
-
-// consts maps canonical encoding name to internal constant.
-var consts = map[string]string{
- "utf-8": "utf8",
- "ibm866": "ibm866",
- "iso-8859-2": "iso8859_2",
- "iso-8859-3": "iso8859_3",
- "iso-8859-4": "iso8859_4",
- "iso-8859-5": "iso8859_5",
- "iso-8859-6": "iso8859_6",
- "iso-8859-7": "iso8859_7",
- "iso-8859-8": "iso8859_8",
- "iso-8859-8-i": "iso8859_8I",
- "iso-8859-10": "iso8859_10",
- "iso-8859-13": "iso8859_13",
- "iso-8859-14": "iso8859_14",
- "iso-8859-15": "iso8859_15",
- "iso-8859-16": "iso8859_16",
- "koi8-r": "koi8r",
- "koi8-u": "koi8u",
- "macintosh": "macintosh",
- "windows-874": "windows874",
- "windows-1250": "windows1250",
- "windows-1251": "windows1251",
- "windows-1252": "windows1252",
- "windows-1253": "windows1253",
- "windows-1254": "windows1254",
- "windows-1255": "windows1255",
- "windows-1256": "windows1256",
- "windows-1257": "windows1257",
- "windows-1258": "windows1258",
- "x-mac-cyrillic": "macintoshCyrillic",
- "gbk": "gbk",
- "gb18030": "gb18030",
- // "hz-gb-2312": "hzgb2312", // Was removed from WhatWG
- "big5": "big5",
- "euc-jp": "eucjp",
- "iso-2022-jp": "iso2022jp",
- "shift_jis": "shiftJIS",
- "euc-kr": "euckr",
- "replacement": "replacement",
- "utf-16be": "utf16be",
- "utf-16le": "utf16le",
- "x-user-defined": "xUserDefined",
-}
-
-// locales is taken from
-// https://html.spec.whatwg.org/multipage/syntax.html#encoding-sniffing-algorithm.
-var locales = []struct{ tag, name string }{
- // The default value. Explicitly state latin to benefit from the exact
- // script option, while still making 1252 the default encoding for languages
- // written in Latin script.
- {"und_Latn", "windows-1252"},
- {"ar", "windows-1256"},
- {"ba", "windows-1251"},
- {"be", "windows-1251"},
- {"bg", "windows-1251"},
- {"cs", "windows-1250"},
- {"el", "iso-8859-7"},
- {"et", "windows-1257"},
- {"fa", "windows-1256"},
- {"he", "windows-1255"},
- {"hr", "windows-1250"},
- {"hu", "iso-8859-2"},
- {"ja", "shift_jis"},
- {"kk", "windows-1251"},
- {"ko", "euc-kr"},
- {"ku", "windows-1254"},
- {"ky", "windows-1251"},
- {"lt", "windows-1257"},
- {"lv", "windows-1257"},
- {"mk", "windows-1251"},
- {"pl", "iso-8859-2"},
- {"ru", "windows-1251"},
- {"sah", "windows-1251"},
- {"sk", "windows-1250"},
- {"sl", "iso-8859-2"},
- {"sr", "windows-1251"},
- {"tg", "windows-1251"},
- {"th", "windows-874"},
- {"tr", "windows-1254"},
- {"tt", "windows-1251"},
- {"uk", "windows-1251"},
- {"vi", "windows-1258"},
- {"zh-hans", "gb18030"},
- {"zh-hant", "big5"},
-}
diff --git a/vendor/golang.org/x/text/encoding/htmlindex/tables.go b/vendor/golang.org/x/text/encoding/htmlindex/tables.go
index 9d6b431..f074e2c 100644
--- a/vendor/golang.org/x/text/encoding/htmlindex/tables.go
+++ b/vendor/golang.org/x/text/encoding/htmlindex/tables.go
@@ -306,6 +306,7 @@ var nameMap = map[string]htmlEncoding{
"iso-2022-cn": replacement,
"iso-2022-cn-ext": replacement,
"iso-2022-kr": replacement,
+ "replacement": replacement,
"utf-16be": utf16be,
"utf-16": utf16le,
"utf-16le": utf16le,
diff --git a/vendor/golang.org/x/text/encoding/internal/identifier/gen.go b/vendor/golang.org/x/text/encoding/internal/identifier/gen.go
deleted file mode 100644
index 0c8eba7..0000000
--- a/vendor/golang.org/x/text/encoding/internal/identifier/gen.go
+++ /dev/null
@@ -1,137 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-import (
- "bytes"
- "encoding/xml"
- "fmt"
- "io"
- "log"
- "strings"
-
- "golang.org/x/text/internal/gen"
-)
-
-type registry struct {
- XMLName xml.Name `xml:"registry"`
- Updated string `xml:"updated"`
- Registry []struct {
- ID string `xml:"id,attr"`
- Record []struct {
- Name string `xml:"name"`
- Xref []struct {
- Type string `xml:"type,attr"`
- Data string `xml:"data,attr"`
- } `xml:"xref"`
- Desc struct {
- Data string `xml:",innerxml"`
- // Any []struct {
- // Data string `xml:",chardata"`
- // } `xml:",any"`
- // Data string `xml:",chardata"`
- } `xml:"description,"`
- MIB string `xml:"value"`
- Alias []string `xml:"alias"`
- MIME string `xml:"preferred_alias"`
- } `xml:"record"`
- } `xml:"registry"`
-}
-
-func main() {
- r := gen.OpenIANAFile("assignments/character-sets/character-sets.xml")
- reg := &registry{}
- if err := xml.NewDecoder(r).Decode(&reg); err != nil && err != io.EOF {
- log.Fatalf("Error decoding charset registry: %v", err)
- }
- if len(reg.Registry) == 0 || reg.Registry[0].ID != "character-sets-1" {
- log.Fatalf("Unexpected ID %s", reg.Registry[0].ID)
- }
-
- w := &bytes.Buffer{}
- fmt.Fprintf(w, "const (\n")
- for _, rec := range reg.Registry[0].Record {
- constName := ""
- for _, a := range rec.Alias {
- if strings.HasPrefix(a, "cs") && strings.IndexByte(a, '-') == -1 {
- // Some of the constant definitions have comments in them. Strip those.
- constName = strings.Title(strings.SplitN(a[2:], "\n", 2)[0])
- }
- }
- if constName == "" {
- switch rec.MIB {
- case "2085":
- constName = "HZGB2312" // Not listed as alias for some reason.
- default:
- log.Fatalf("No cs alias defined for %s.", rec.MIB)
- }
- }
- if rec.MIME != "" {
- rec.MIME = fmt.Sprintf(" (MIME: %s)", rec.MIME)
- }
- fmt.Fprintf(w, "// %s is the MIB identifier with IANA name %s%s.\n//\n", constName, rec.Name, rec.MIME)
- if len(rec.Desc.Data) > 0 {
- fmt.Fprint(w, "// ")
- d := xml.NewDecoder(strings.NewReader(rec.Desc.Data))
- inElem := true
- attr := ""
- for {
- t, err := d.Token()
- if err != nil {
- if err != io.EOF {
- log.Fatal(err)
- }
- break
- }
- switch x := t.(type) {
- case xml.CharData:
- attr = "" // Don't need attribute info.
- a := bytes.Split([]byte(x), []byte("\n"))
- for i, b := range a {
- if b = bytes.TrimSpace(b); len(b) != 0 {
- if !inElem && i > 0 {
- fmt.Fprint(w, "\n// ")
- }
- inElem = false
- fmt.Fprintf(w, "%s ", string(b))
- }
- }
- case xml.StartElement:
- if x.Name.Local == "xref" {
- inElem = true
- use := false
- for _, a := range x.Attr {
- if a.Name.Local == "type" {
- use = use || a.Value != "person"
- }
- if a.Name.Local == "data" && use {
- attr = a.Value + " "
- }
- }
- }
- case xml.EndElement:
- inElem = false
- fmt.Fprint(w, attr)
- }
- }
- fmt.Fprint(w, "\n")
- }
- for _, x := range rec.Xref {
- switch x.Type {
- case "rfc":
- fmt.Fprintf(w, "// Reference: %s\n", strings.ToUpper(x.Data))
- case "uri":
- fmt.Fprintf(w, "// Reference: %s\n", x.Data)
- }
- }
- fmt.Fprintf(w, "%s MIB = %s\n", constName, rec.MIB)
- fmt.Fprintln(w)
- }
- fmt.Fprintln(w, ")")
-
- gen.WriteGoFile("mib.go", "identifier", w.Bytes())
-}
diff --git a/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go b/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go
index 7351b4e..5c9b85c 100644
--- a/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go
+++ b/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go
@@ -34,7 +34,7 @@ package identifier
// - http://www.iana.org/assignments/character-sets/character-sets.xhtml
// - http://www.iana.org/assignments/ianacharset-mib/ianacharset-mib
// - http://www.ietf.org/rfc/rfc2978.txt
-// - http://www.unicode.org/reports/tr22/
+// - https://www.unicode.org/reports/tr22/
// - http://www.w3.org/TR/encoding/
// - https://encoding.spec.whatwg.org/
// - https://encoding.spec.whatwg.org/encodings.json
diff --git a/vendor/golang.org/x/text/encoding/internal/identifier/mib.go b/vendor/golang.org/x/text/encoding/internal/identifier/mib.go
index 768842b..fc7df1b 100644
--- a/vendor/golang.org/x/text/encoding/internal/identifier/mib.go
+++ b/vendor/golang.org/x/text/encoding/internal/identifier/mib.go
@@ -538,8 +538,6 @@ const (
// ISO111ECMACyrillic is the MIB identifier with IANA name ECMA-cyrillic.
//
// ISO registry
- // (formerly ECMA
- // registry )
ISO111ECMACyrillic MIB = 77
// ISO121Canadian1 is the MIB identifier with IANA name CSA_Z243.4-1985-1.
@@ -732,18 +730,18 @@ const (
// ISO885913 is the MIB identifier with IANA name ISO-8859-13.
//
- // ISO See http://www.iana.org/assignments/charset-reg/ISO-8859-13 http://www.iana.org/assignments/charset-reg/ISO-8859-13
+ // ISO See https://www.iana.org/assignments/charset-reg/ISO-8859-13 https://www.iana.org/assignments/charset-reg/ISO-8859-13
ISO885913 MIB = 109
// ISO885914 is the MIB identifier with IANA name ISO-8859-14.
//
- // ISO See http://www.iana.org/assignments/charset-reg/ISO-8859-14
+ // ISO See https://www.iana.org/assignments/charset-reg/ISO-8859-14
ISO885914 MIB = 110
// ISO885915 is the MIB identifier with IANA name ISO-8859-15.
//
// ISO
- // Please see: http://www.iana.org/assignments/charset-reg/ISO-8859-15
+ // Please see: https://www.iana.org/assignments/charset-reg/ISO-8859-15
ISO885915 MIB = 111
// ISO885916 is the MIB identifier with IANA name ISO-8859-16.
@@ -754,41 +752,41 @@ const (
// GBK is the MIB identifier with IANA name GBK.
//
// Chinese IT Standardization Technical Committee
- // Please see: http://www.iana.org/assignments/charset-reg/GBK
+ // Please see: https://www.iana.org/assignments/charset-reg/GBK
GBK MIB = 113
// GB18030 is the MIB identifier with IANA name GB18030.
//
// Chinese IT Standardization Technical Committee
- // Please see: http://www.iana.org/assignments/charset-reg/GB18030
+ // Please see: https://www.iana.org/assignments/charset-reg/GB18030
GB18030 MIB = 114
// OSDEBCDICDF0415 is the MIB identifier with IANA name OSD_EBCDIC_DF04_15.
//
// Fujitsu-Siemens standard mainframe EBCDIC encoding
- // Please see: http://www.iana.org/assignments/charset-reg/OSD-EBCDIC-DF04-15
+ // Please see: https://www.iana.org/assignments/charset-reg/OSD-EBCDIC-DF04-15
OSDEBCDICDF0415 MIB = 115
// OSDEBCDICDF03IRV is the MIB identifier with IANA name OSD_EBCDIC_DF03_IRV.
//
// Fujitsu-Siemens standard mainframe EBCDIC encoding
- // Please see: http://www.iana.org/assignments/charset-reg/OSD-EBCDIC-DF03-IRV
+ // Please see: https://www.iana.org/assignments/charset-reg/OSD-EBCDIC-DF03-IRV
OSDEBCDICDF03IRV MIB = 116
// OSDEBCDICDF041 is the MIB identifier with IANA name OSD_EBCDIC_DF04_1.
//
// Fujitsu-Siemens standard mainframe EBCDIC encoding
- // Please see: http://www.iana.org/assignments/charset-reg/OSD-EBCDIC-DF04-1
+ // Please see: https://www.iana.org/assignments/charset-reg/OSD-EBCDIC-DF04-1
OSDEBCDICDF041 MIB = 117
// ISO115481 is the MIB identifier with IANA name ISO-11548-1.
//
- // See http://www.iana.org/assignments/charset-reg/ISO-11548-1
+ // See https://www.iana.org/assignments/charset-reg/ISO-11548-1
ISO115481 MIB = 118
// KZ1048 is the MIB identifier with IANA name KZ-1048.
//
- // See http://www.iana.org/assignments/charset-reg/KZ-1048
+ // See https://www.iana.org/assignments/charset-reg/KZ-1048
KZ1048 MIB = 119
// Unicode is the MIB identifier with IANA name ISO-10646-UCS-2.
@@ -855,7 +853,7 @@ const (
// SCSU is the MIB identifier with IANA name SCSU.
//
- // SCSU See http://www.iana.org/assignments/charset-reg/SCSU
+ // SCSU See https://www.iana.org/assignments/charset-reg/SCSU
SCSU MIB = 1011
// UTF7 is the MIB identifier with IANA name UTF-7.
@@ -884,27 +882,27 @@ const (
// CESU8 is the MIB identifier with IANA name CESU-8.
//
- // http://www.unicode.org/unicode/reports/tr26
+ // https://www.unicode.org/reports/tr26
CESU8 MIB = 1016
// UTF32 is the MIB identifier with IANA name UTF-32.
//
- // http://www.unicode.org/unicode/reports/tr19/
+ // https://www.unicode.org/reports/tr19/
UTF32 MIB = 1017
// UTF32BE is the MIB identifier with IANA name UTF-32BE.
//
- // http://www.unicode.org/unicode/reports/tr19/
+ // https://www.unicode.org/reports/tr19/
UTF32BE MIB = 1018
// UTF32LE is the MIB identifier with IANA name UTF-32LE.
//
- // http://www.unicode.org/unicode/reports/tr19/
+ // https://www.unicode.org/reports/tr19/
UTF32LE MIB = 1019
// BOCU1 is the MIB identifier with IANA name BOCU-1.
//
- // http://www.unicode.org/notes/tn6/
+ // https://www.unicode.org/notes/tn6/
BOCU1 MIB = 1020
// Windows30Latin1 is the MIB identifier with IANA name ISO-8859-1-Windows-3.0-Latin-1.
@@ -1461,152 +1459,152 @@ const (
// IBM00858 is the MIB identifier with IANA name IBM00858.
//
- // IBM See http://www.iana.org/assignments/charset-reg/IBM00858
+ // IBM See https://www.iana.org/assignments/charset-reg/IBM00858
IBM00858 MIB = 2089
// IBM00924 is the MIB identifier with IANA name IBM00924.
//
- // IBM See http://www.iana.org/assignments/charset-reg/IBM00924
+ // IBM See https://www.iana.org/assignments/charset-reg/IBM00924
IBM00924 MIB = 2090
// IBM01140 is the MIB identifier with IANA name IBM01140.
//
- // IBM See http://www.iana.org/assignments/charset-reg/IBM01140
+ // IBM See https://www.iana.org/assignments/charset-reg/IBM01140
IBM01140 MIB = 2091
// IBM01141 is the MIB identifier with IANA name IBM01141.
//
- // IBM See http://www.iana.org/assignments/charset-reg/IBM01141
+ // IBM See https://www.iana.org/assignments/charset-reg/IBM01141
IBM01141 MIB = 2092
// IBM01142 is the MIB identifier with IANA name IBM01142.
//
- // IBM See http://www.iana.org/assignments/charset-reg/IBM01142
+ // IBM See https://www.iana.org/assignments/charset-reg/IBM01142
IBM01142 MIB = 2093
// IBM01143 is the MIB identifier with IANA name IBM01143.
//
- // IBM See http://www.iana.org/assignments/charset-reg/IBM01143
+ // IBM See https://www.iana.org/assignments/charset-reg/IBM01143
IBM01143 MIB = 2094
// IBM01144 is the MIB identifier with IANA name IBM01144.
//
- // IBM See http://www.iana.org/assignments/charset-reg/IBM01144
+ // IBM See https://www.iana.org/assignments/charset-reg/IBM01144
IBM01144 MIB = 2095
// IBM01145 is the MIB identifier with IANA name IBM01145.
//
- // IBM See http://www.iana.org/assignments/charset-reg/IBM01145
+ // IBM See https://www.iana.org/assignments/charset-reg/IBM01145
IBM01145 MIB = 2096
// IBM01146 is the MIB identifier with IANA name IBM01146.
//
- // IBM See http://www.iana.org/assignments/charset-reg/IBM01146
+ // IBM See https://www.iana.org/assignments/charset-reg/IBM01146
IBM01146 MIB = 2097
// IBM01147 is the MIB identifier with IANA name IBM01147.
//
- // IBM See http://www.iana.org/assignments/charset-reg/IBM01147
+ // IBM See https://www.iana.org/assignments/charset-reg/IBM01147
IBM01147 MIB = 2098
// IBM01148 is the MIB identifier with IANA name IBM01148.
//
- // IBM See http://www.iana.org/assignments/charset-reg/IBM01148
+ // IBM See https://www.iana.org/assignments/charset-reg/IBM01148
IBM01148 MIB = 2099
// IBM01149 is the MIB identifier with IANA name IBM01149.
//
- // IBM See http://www.iana.org/assignments/charset-reg/IBM01149
+ // IBM See https://www.iana.org/assignments/charset-reg/IBM01149
IBM01149 MIB = 2100
// Big5HKSCS is the MIB identifier with IANA name Big5-HKSCS.
//
- // See http://www.iana.org/assignments/charset-reg/Big5-HKSCS
+ // See https://www.iana.org/assignments/charset-reg/Big5-HKSCS
Big5HKSCS MIB = 2101
// IBM1047 is the MIB identifier with IANA name IBM1047.
//
- // IBM1047 (EBCDIC Latin 1/Open Systems) http://www-1.ibm.com/servers/eserver/iseries/software/globalization/pdf/cp01047z.pdf
+ // IBM1047 (EBCDIC Latin 1/Open Systems) https://www-1.ibm.com/servers/eserver/iseries/software/globalization/pdf/cp01047z.pdf
IBM1047 MIB = 2102
// PTCP154 is the MIB identifier with IANA name PTCP154.
//
- // See http://www.iana.org/assignments/charset-reg/PTCP154
+ // See https://www.iana.org/assignments/charset-reg/PTCP154
PTCP154 MIB = 2103
// Amiga1251 is the MIB identifier with IANA name Amiga-1251.
//
- // See http://www.amiga.ultranet.ru/Amiga-1251.html
+ // See https://www.amiga.ultranet.ru/Amiga-1251.html
Amiga1251 MIB = 2104
// KOI7switched is the MIB identifier with IANA name KOI7-switched.
//
- // See http://www.iana.org/assignments/charset-reg/KOI7-switched
+ // See https://www.iana.org/assignments/charset-reg/KOI7-switched
KOI7switched MIB = 2105
// BRF is the MIB identifier with IANA name BRF.
//
- // See http://www.iana.org/assignments/charset-reg/BRF
+ // See https://www.iana.org/assignments/charset-reg/BRF
BRF MIB = 2106
// TSCII is the MIB identifier with IANA name TSCII.
//
- // See http://www.iana.org/assignments/charset-reg/TSCII
+ // See https://www.iana.org/assignments/charset-reg/TSCII
TSCII MIB = 2107
// CP51932 is the MIB identifier with IANA name CP51932.
//
- // See http://www.iana.org/assignments/charset-reg/CP51932
+ // See https://www.iana.org/assignments/charset-reg/CP51932
CP51932 MIB = 2108
// Windows874 is the MIB identifier with IANA name windows-874.
//
- // See http://www.iana.org/assignments/charset-reg/windows-874
+ // See https://www.iana.org/assignments/charset-reg/windows-874
Windows874 MIB = 2109
// Windows1250 is the MIB identifier with IANA name windows-1250.
//
- // Microsoft http://www.iana.org/assignments/charset-reg/windows-1250
+ // Microsoft https://www.iana.org/assignments/charset-reg/windows-1250
Windows1250 MIB = 2250
// Windows1251 is the MIB identifier with IANA name windows-1251.
//
- // Microsoft http://www.iana.org/assignments/charset-reg/windows-1251
+ // Microsoft https://www.iana.org/assignments/charset-reg/windows-1251
Windows1251 MIB = 2251
// Windows1252 is the MIB identifier with IANA name windows-1252.
//
- // Microsoft http://www.iana.org/assignments/charset-reg/windows-1252
+ // Microsoft https://www.iana.org/assignments/charset-reg/windows-1252
Windows1252 MIB = 2252
// Windows1253 is the MIB identifier with IANA name windows-1253.
//
- // Microsoft http://www.iana.org/assignments/charset-reg/windows-1253
+ // Microsoft https://www.iana.org/assignments/charset-reg/windows-1253
Windows1253 MIB = 2253
// Windows1254 is the MIB identifier with IANA name windows-1254.
//
- // Microsoft http://www.iana.org/assignments/charset-reg/windows-1254
+ // Microsoft https://www.iana.org/assignments/charset-reg/windows-1254
Windows1254 MIB = 2254
// Windows1255 is the MIB identifier with IANA name windows-1255.
//
- // Microsoft http://www.iana.org/assignments/charset-reg/windows-1255
+ // Microsoft https://www.iana.org/assignments/charset-reg/windows-1255
Windows1255 MIB = 2255
// Windows1256 is the MIB identifier with IANA name windows-1256.
//
- // Microsoft http://www.iana.org/assignments/charset-reg/windows-1256
+ // Microsoft https://www.iana.org/assignments/charset-reg/windows-1256
Windows1256 MIB = 2256
// Windows1257 is the MIB identifier with IANA name windows-1257.
//
- // Microsoft http://www.iana.org/assignments/charset-reg/windows-1257
+ // Microsoft https://www.iana.org/assignments/charset-reg/windows-1257
Windows1257 MIB = 2257
// Windows1258 is the MIB identifier with IANA name windows-1258.
//
- // Microsoft http://www.iana.org/assignments/charset-reg/windows-1258
+ // Microsoft https://www.iana.org/assignments/charset-reg/windows-1258
Windows1258 MIB = 2258
// TIS620 is the MIB identifier with IANA name TIS-620.
@@ -1616,6 +1614,6 @@ const (
// CP50220 is the MIB identifier with IANA name CP50220.
//
- // See http://www.iana.org/assignments/charset-reg/CP50220
+ // See https://www.iana.org/assignments/charset-reg/CP50220
CP50220 MIB = 2260
)
diff --git a/vendor/golang.org/x/text/encoding/japanese/maketables.go b/vendor/golang.org/x/text/encoding/japanese/maketables.go
deleted file mode 100644
index d6c10de..0000000
--- a/vendor/golang.org/x/text/encoding/japanese/maketables.go
+++ /dev/null
@@ -1,161 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-// This program generates tables.go:
-// go run maketables.go | gofmt > tables.go
-
-// TODO: Emoji extensions?
-// http://www.unicode.org/faq/emoji_dingbats.html
-// http://www.unicode.org/Public/UNIDATA/EmojiSources.txt
-
-import (
- "bufio"
- "fmt"
- "log"
- "net/http"
- "sort"
- "strings"
-)
-
-type entry struct {
- jisCode, table int
-}
-
-func main() {
- fmt.Printf("// generated by go run maketables.go; DO NOT EDIT\n\n")
- fmt.Printf("// Package japanese provides Japanese encodings such as EUC-JP and Shift JIS.\n")
- fmt.Printf(`package japanese // import "golang.org/x/text/encoding/japanese"` + "\n\n")
-
- reverse := [65536]entry{}
- for i := range reverse {
- reverse[i].table = -1
- }
-
- tables := []struct {
- url string
- name string
- }{
- {"http://encoding.spec.whatwg.org/index-jis0208.txt", "0208"},
- {"http://encoding.spec.whatwg.org/index-jis0212.txt", "0212"},
- }
- for i, table := range tables {
- res, err := http.Get(table.url)
- if err != nil {
- log.Fatalf("%q: Get: %v", table.url, err)
- }
- defer res.Body.Close()
-
- mapping := [65536]uint16{}
-
- scanner := bufio.NewScanner(res.Body)
- for scanner.Scan() {
- s := strings.TrimSpace(scanner.Text())
- if s == "" || s[0] == '#' {
- continue
- }
- x, y := 0, uint16(0)
- if _, err := fmt.Sscanf(s, "%d 0x%x", &x, &y); err != nil {
- log.Fatalf("%q: could not parse %q", table.url, s)
- }
- if x < 0 || 120*94 <= x {
- log.Fatalf("%q: JIS code %d is out of range", table.url, x)
- }
- mapping[x] = y
- if reverse[y].table == -1 {
- reverse[y] = entry{jisCode: x, table: i}
- }
- }
- if err := scanner.Err(); err != nil {
- log.Fatalf("%q: scanner error: %v", table.url, err)
- }
-
- fmt.Printf("// jis%sDecode is the decoding table from JIS %s code to Unicode.\n// It is defined at %s\n",
- table.name, table.name, table.url)
- fmt.Printf("var jis%sDecode = [...]uint16{\n", table.name)
- for i, m := range mapping {
- if m != 0 {
- fmt.Printf("\t%d: 0x%04X,\n", i, m)
- }
- }
- fmt.Printf("}\n\n")
- }
-
- // Any run of at least separation continuous zero entries in the reverse map will
- // be a separate encode table.
- const separation = 1024
-
- intervals := []interval(nil)
- low, high := -1, -1
- for i, v := range reverse {
- if v.table == -1 {
- continue
- }
- if low < 0 {
- low = i
- } else if i-high >= separation {
- if high >= 0 {
- intervals = append(intervals, interval{low, high})
- }
- low = i
- }
- high = i + 1
- }
- if high >= 0 {
- intervals = append(intervals, interval{low, high})
- }
- sort.Sort(byDecreasingLength(intervals))
-
- fmt.Printf("const (\n")
- fmt.Printf("\tjis0208 = 1\n")
- fmt.Printf("\tjis0212 = 2\n")
- fmt.Printf("\tcodeMask = 0x7f\n")
- fmt.Printf("\tcodeShift = 7\n")
- fmt.Printf("\ttableShift = 14\n")
- fmt.Printf(")\n\n")
-
- fmt.Printf("const numEncodeTables = %d\n\n", len(intervals))
- fmt.Printf("// encodeX are the encoding tables from Unicode to JIS code,\n")
- fmt.Printf("// sorted by decreasing length.\n")
- for i, v := range intervals {
- fmt.Printf("// encode%d: %5d entries for runes in [%5d, %5d).\n", i, v.len(), v.low, v.high)
- }
- fmt.Printf("//\n")
- fmt.Printf("// The high two bits of the value record whether the JIS code comes from the\n")
- fmt.Printf("// JIS0208 table (high bits == 1) or the JIS0212 table (high bits == 2).\n")
- fmt.Printf("// The low 14 bits are two 7-bit unsigned integers j1 and j2 that form the\n")
- fmt.Printf("// JIS code (94*j1 + j2) within that table.\n")
- fmt.Printf("\n")
-
- for i, v := range intervals {
- fmt.Printf("const encode%dLow, encode%dHigh = %d, %d\n\n", i, i, v.low, v.high)
- fmt.Printf("var encode%d = [...]uint16{\n", i)
- for j := v.low; j < v.high; j++ {
- x := reverse[j]
- if x.table == -1 {
- continue
- }
- fmt.Printf("\t%d - %d: jis%s<<14 | 0x%02X<<7 | 0x%02X,\n",
- j, v.low, tables[x.table].name, x.jisCode/94, x.jisCode%94)
- }
- fmt.Printf("}\n\n")
- }
-}
-
-// interval is a half-open interval [low, high).
-type interval struct {
- low, high int
-}
-
-func (i interval) len() int { return i.high - i.low }
-
-// byDecreasingLength sorts intervals by decreasing length.
-type byDecreasingLength []interval
-
-func (b byDecreasingLength) Len() int { return len(b) }
-func (b byDecreasingLength) Less(i, j int) bool { return b[i].len() > b[j].len() }
-func (b byDecreasingLength) Swap(i, j int) { b[i], b[j] = b[j], b[i] }
diff --git a/vendor/golang.org/x/text/encoding/korean/maketables.go b/vendor/golang.org/x/text/encoding/korean/maketables.go
deleted file mode 100644
index c84034f..0000000
--- a/vendor/golang.org/x/text/encoding/korean/maketables.go
+++ /dev/null
@@ -1,143 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-// This program generates tables.go:
-// go run maketables.go | gofmt > tables.go
-
-import (
- "bufio"
- "fmt"
- "log"
- "net/http"
- "sort"
- "strings"
-)
-
-func main() {
- fmt.Printf("// generated by go run maketables.go; DO NOT EDIT\n\n")
- fmt.Printf("// Package korean provides Korean encodings such as EUC-KR.\n")
- fmt.Printf(`package korean // import "golang.org/x/text/encoding/korean"` + "\n\n")
-
- res, err := http.Get("http://encoding.spec.whatwg.org/index-euc-kr.txt")
- if err != nil {
- log.Fatalf("Get: %v", err)
- }
- defer res.Body.Close()
-
- mapping := [65536]uint16{}
- reverse := [65536]uint16{}
-
- scanner := bufio.NewScanner(res.Body)
- for scanner.Scan() {
- s := strings.TrimSpace(scanner.Text())
- if s == "" || s[0] == '#' {
- continue
- }
- x, y := uint16(0), uint16(0)
- if _, err := fmt.Sscanf(s, "%d 0x%x", &x, &y); err != nil {
- log.Fatalf("could not parse %q", s)
- }
- if x < 0 || 178*(0xc7-0x81)+(0xfe-0xc7)*94+(0xff-0xa1) <= x {
- log.Fatalf("EUC-KR code %d is out of range", x)
- }
- mapping[x] = y
- if reverse[y] == 0 {
- c0, c1 := uint16(0), uint16(0)
- if x < 178*(0xc7-0x81) {
- c0 = uint16(x/178) + 0x81
- c1 = uint16(x % 178)
- switch {
- case c1 < 1*26:
- c1 += 0x41
- case c1 < 2*26:
- c1 += 0x47
- default:
- c1 += 0x4d
- }
- } else {
- x -= 178 * (0xc7 - 0x81)
- c0 = uint16(x/94) + 0xc7
- c1 = uint16(x%94) + 0xa1
- }
- reverse[y] = c0<<8 | c1
- }
- }
- if err := scanner.Err(); err != nil {
- log.Fatalf("scanner error: %v", err)
- }
-
- fmt.Printf("// decode is the decoding table from EUC-KR code to Unicode.\n")
- fmt.Printf("// It is defined at http://encoding.spec.whatwg.org/index-euc-kr.txt\n")
- fmt.Printf("var decode = [...]uint16{\n")
- for i, v := range mapping {
- if v != 0 {
- fmt.Printf("\t%d: 0x%04X,\n", i, v)
- }
- }
- fmt.Printf("}\n\n")
-
- // Any run of at least separation continuous zero entries in the reverse map will
- // be a separate encode table.
- const separation = 1024
-
- intervals := []interval(nil)
- low, high := -1, -1
- for i, v := range reverse {
- if v == 0 {
- continue
- }
- if low < 0 {
- low = i
- } else if i-high >= separation {
- if high >= 0 {
- intervals = append(intervals, interval{low, high})
- }
- low = i
- }
- high = i + 1
- }
- if high >= 0 {
- intervals = append(intervals, interval{low, high})
- }
- sort.Sort(byDecreasingLength(intervals))
-
- fmt.Printf("const numEncodeTables = %d\n\n", len(intervals))
- fmt.Printf("// encodeX are the encoding tables from Unicode to EUC-KR code,\n")
- fmt.Printf("// sorted by decreasing length.\n")
- for i, v := range intervals {
- fmt.Printf("// encode%d: %5d entries for runes in [%5d, %5d).\n", i, v.len(), v.low, v.high)
- }
- fmt.Printf("\n")
-
- for i, v := range intervals {
- fmt.Printf("const encode%dLow, encode%dHigh = %d, %d\n\n", i, i, v.low, v.high)
- fmt.Printf("var encode%d = [...]uint16{\n", i)
- for j := v.low; j < v.high; j++ {
- x := reverse[j]
- if x == 0 {
- continue
- }
- fmt.Printf("\t%d-%d: 0x%04X,\n", j, v.low, x)
- }
- fmt.Printf("}\n\n")
- }
-}
-
-// interval is a half-open interval [low, high).
-type interval struct {
- low, high int
-}
-
-func (i interval) len() int { return i.high - i.low }
-
-// byDecreasingLength sorts intervals by decreasing length.
-type byDecreasingLength []interval
-
-func (b byDecreasingLength) Len() int { return len(b) }
-func (b byDecreasingLength) Less(i, j int) bool { return b[i].len() > b[j].len() }
-func (b byDecreasingLength) Swap(i, j int) { b[i], b[j] = b[j], b[i] }
diff --git a/vendor/golang.org/x/text/encoding/simplifiedchinese/maketables.go b/vendor/golang.org/x/text/encoding/simplifiedchinese/maketables.go
deleted file mode 100644
index 55016c7..0000000
--- a/vendor/golang.org/x/text/encoding/simplifiedchinese/maketables.go
+++ /dev/null
@@ -1,161 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-// This program generates tables.go:
-// go run maketables.go | gofmt > tables.go
-
-import (
- "bufio"
- "fmt"
- "log"
- "net/http"
- "sort"
- "strings"
-)
-
-func main() {
- fmt.Printf("// generated by go run maketables.go; DO NOT EDIT\n\n")
- fmt.Printf("// Package simplifiedchinese provides Simplified Chinese encodings such as GBK.\n")
- fmt.Printf(`package simplifiedchinese // import "golang.org/x/text/encoding/simplifiedchinese"` + "\n\n")
-
- printGB18030()
- printGBK()
-}
-
-func printGB18030() {
- res, err := http.Get("http://encoding.spec.whatwg.org/index-gb18030.txt")
- if err != nil {
- log.Fatalf("Get: %v", err)
- }
- defer res.Body.Close()
-
- fmt.Printf("// gb18030 is the table from http://encoding.spec.whatwg.org/index-gb18030.txt\n")
- fmt.Printf("var gb18030 = [...][2]uint16{\n")
- scanner := bufio.NewScanner(res.Body)
- for scanner.Scan() {
- s := strings.TrimSpace(scanner.Text())
- if s == "" || s[0] == '#' {
- continue
- }
- x, y := uint32(0), uint32(0)
- if _, err := fmt.Sscanf(s, "%d 0x%x", &x, &y); err != nil {
- log.Fatalf("could not parse %q", s)
- }
- if x < 0x10000 && y < 0x10000 {
- fmt.Printf("\t{0x%04x, 0x%04x},\n", x, y)
- }
- }
- fmt.Printf("}\n\n")
-}
-
-func printGBK() {
- res, err := http.Get("http://encoding.spec.whatwg.org/index-gbk.txt")
- if err != nil {
- log.Fatalf("Get: %v", err)
- }
- defer res.Body.Close()
-
- mapping := [65536]uint16{}
- reverse := [65536]uint16{}
-
- scanner := bufio.NewScanner(res.Body)
- for scanner.Scan() {
- s := strings.TrimSpace(scanner.Text())
- if s == "" || s[0] == '#' {
- continue
- }
- x, y := uint16(0), uint16(0)
- if _, err := fmt.Sscanf(s, "%d 0x%x", &x, &y); err != nil {
- log.Fatalf("could not parse %q", s)
- }
- if x < 0 || 126*190 <= x {
- log.Fatalf("GBK code %d is out of range", x)
- }
- mapping[x] = y
- if reverse[y] == 0 {
- c0, c1 := x/190, x%190
- if c1 >= 0x3f {
- c1++
- }
- reverse[y] = (0x81+c0)<<8 | (0x40 + c1)
- }
- }
- if err := scanner.Err(); err != nil {
- log.Fatalf("scanner error: %v", err)
- }
-
- fmt.Printf("// decode is the decoding table from GBK code to Unicode.\n")
- fmt.Printf("// It is defined at http://encoding.spec.whatwg.org/index-gbk.txt\n")
- fmt.Printf("var decode = [...]uint16{\n")
- for i, v := range mapping {
- if v != 0 {
- fmt.Printf("\t%d: 0x%04X,\n", i, v)
- }
- }
- fmt.Printf("}\n\n")
-
- // Any run of at least separation continuous zero entries in the reverse map will
- // be a separate encode table.
- const separation = 1024
-
- intervals := []interval(nil)
- low, high := -1, -1
- for i, v := range reverse {
- if v == 0 {
- continue
- }
- if low < 0 {
- low = i
- } else if i-high >= separation {
- if high >= 0 {
- intervals = append(intervals, interval{low, high})
- }
- low = i
- }
- high = i + 1
- }
- if high >= 0 {
- intervals = append(intervals, interval{low, high})
- }
- sort.Sort(byDecreasingLength(intervals))
-
- fmt.Printf("const numEncodeTables = %d\n\n", len(intervals))
- fmt.Printf("// encodeX are the encoding tables from Unicode to GBK code,\n")
- fmt.Printf("// sorted by decreasing length.\n")
- for i, v := range intervals {
- fmt.Printf("// encode%d: %5d entries for runes in [%5d, %5d).\n", i, v.len(), v.low, v.high)
- }
- fmt.Printf("\n")
-
- for i, v := range intervals {
- fmt.Printf("const encode%dLow, encode%dHigh = %d, %d\n\n", i, i, v.low, v.high)
- fmt.Printf("var encode%d = [...]uint16{\n", i)
- for j := v.low; j < v.high; j++ {
- x := reverse[j]
- if x == 0 {
- continue
- }
- fmt.Printf("\t%d-%d: 0x%04X,\n", j, v.low, x)
- }
- fmt.Printf("}\n\n")
- }
-}
-
-// interval is a half-open interval [low, high).
-type interval struct {
- low, high int
-}
-
-func (i interval) len() int { return i.high - i.low }
-
-// byDecreasingLength sorts intervals by decreasing length.
-type byDecreasingLength []interval
-
-func (b byDecreasingLength) Len() int { return len(b) }
-func (b byDecreasingLength) Less(i, j int) bool { return b[i].len() > b[j].len() }
-func (b byDecreasingLength) Swap(i, j int) { b[i], b[j] = b[j], b[i] }
diff --git a/vendor/golang.org/x/text/encoding/traditionalchinese/maketables.go b/vendor/golang.org/x/text/encoding/traditionalchinese/maketables.go
deleted file mode 100644
index cf7fdb3..0000000
--- a/vendor/golang.org/x/text/encoding/traditionalchinese/maketables.go
+++ /dev/null
@@ -1,140 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-// This program generates tables.go:
-// go run maketables.go | gofmt > tables.go
-
-import (
- "bufio"
- "fmt"
- "log"
- "net/http"
- "sort"
- "strings"
-)
-
-func main() {
- fmt.Printf("// generated by go run maketables.go; DO NOT EDIT\n\n")
- fmt.Printf("// Package traditionalchinese provides Traditional Chinese encodings such as Big5.\n")
- fmt.Printf(`package traditionalchinese // import "golang.org/x/text/encoding/traditionalchinese"` + "\n\n")
-
- res, err := http.Get("http://encoding.spec.whatwg.org/index-big5.txt")
- if err != nil {
- log.Fatalf("Get: %v", err)
- }
- defer res.Body.Close()
-
- mapping := [65536]uint32{}
- reverse := [65536 * 4]uint16{}
-
- scanner := bufio.NewScanner(res.Body)
- for scanner.Scan() {
- s := strings.TrimSpace(scanner.Text())
- if s == "" || s[0] == '#' {
- continue
- }
- x, y := uint16(0), uint32(0)
- if _, err := fmt.Sscanf(s, "%d 0x%x", &x, &y); err != nil {
- log.Fatalf("could not parse %q", s)
- }
- if x < 0 || 126*157 <= x {
- log.Fatalf("Big5 code %d is out of range", x)
- }
- mapping[x] = y
-
- // The WHATWG spec http://encoding.spec.whatwg.org/#indexes says that
- // "The index pointer for code point in index is the first pointer
- // corresponding to code point in index", which would normally mean
- // that the code below should be guarded by "if reverse[y] == 0", but
- // last instead of first seems to match the behavior of
- // "iconv -f UTF-8 -t BIG5". For example, U+8005 者 occurs twice in
- // http://encoding.spec.whatwg.org/index-big5.txt, as index 2148
- // (encoded as "\x8e\xcd") and index 6543 (encoded as "\xaa\xcc")
- // and "echo 者 | iconv -f UTF-8 -t BIG5 | xxd" gives "\xaa\xcc".
- c0, c1 := x/157, x%157
- if c1 < 0x3f {
- c1 += 0x40
- } else {
- c1 += 0x62
- }
- reverse[y] = (0x81+c0)<<8 | c1
- }
- if err := scanner.Err(); err != nil {
- log.Fatalf("scanner error: %v", err)
- }
-
- fmt.Printf("// decode is the decoding table from Big5 code to Unicode.\n")
- fmt.Printf("// It is defined at http://encoding.spec.whatwg.org/index-big5.txt\n")
- fmt.Printf("var decode = [...]uint32{\n")
- for i, v := range mapping {
- if v != 0 {
- fmt.Printf("\t%d: 0x%08X,\n", i, v)
- }
- }
- fmt.Printf("}\n\n")
-
- // Any run of at least separation continuous zero entries in the reverse map will
- // be a separate encode table.
- const separation = 1024
-
- intervals := []interval(nil)
- low, high := -1, -1
- for i, v := range reverse {
- if v == 0 {
- continue
- }
- if low < 0 {
- low = i
- } else if i-high >= separation {
- if high >= 0 {
- intervals = append(intervals, interval{low, high})
- }
- low = i
- }
- high = i + 1
- }
- if high >= 0 {
- intervals = append(intervals, interval{low, high})
- }
- sort.Sort(byDecreasingLength(intervals))
-
- fmt.Printf("const numEncodeTables = %d\n\n", len(intervals))
- fmt.Printf("// encodeX are the encoding tables from Unicode to Big5 code,\n")
- fmt.Printf("// sorted by decreasing length.\n")
- for i, v := range intervals {
- fmt.Printf("// encode%d: %5d entries for runes in [%6d, %6d).\n", i, v.len(), v.low, v.high)
- }
- fmt.Printf("\n")
-
- for i, v := range intervals {
- fmt.Printf("const encode%dLow, encode%dHigh = %d, %d\n\n", i, i, v.low, v.high)
- fmt.Printf("var encode%d = [...]uint16{\n", i)
- for j := v.low; j < v.high; j++ {
- x := reverse[j]
- if x == 0 {
- continue
- }
- fmt.Printf("\t%d-%d: 0x%04X,\n", j, v.low, x)
- }
- fmt.Printf("}\n\n")
- }
-}
-
-// interval is a half-open interval [low, high).
-type interval struct {
- low, high int
-}
-
-func (i interval) len() int { return i.high - i.low }
-
-// byDecreasingLength sorts intervals by decreasing length.
-type byDecreasingLength []interval
-
-func (b byDecreasingLength) Len() int { return len(b) }
-func (b byDecreasingLength) Less(i, j int) bool { return b[i].len() > b[j].len() }
-func (b byDecreasingLength) Swap(i, j int) { b[i], b[j] = b[j], b[i] }
diff --git a/vendor/golang.org/x/text/encoding/unicode/unicode.go b/vendor/golang.org/x/text/encoding/unicode/unicode.go
index 579cadf..4850ff3 100644
--- a/vendor/golang.org/x/text/encoding/unicode/unicode.go
+++ b/vendor/golang.org/x/text/encoding/unicode/unicode.go
@@ -145,7 +145,7 @@ func (utf8Decoder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err e
// and consumed in a greater context that implies a certain endianness, use
// IgnoreBOM. Otherwise, use ExpectBOM and always produce and consume a BOM.
//
-// In the language of http://www.unicode.org/faq/utf_bom.html#bom10, IgnoreBOM
+// In the language of https://www.unicode.org/faq/utf_bom.html#bom10, IgnoreBOM
// corresponds to "Where the precise type of the data stream is known... the
// BOM should not be used" and ExpectBOM corresponds to "A particular
// protocol... may require use of the BOM".
diff --git a/vendor/golang.org/x/text/internal/gen/code.go b/vendor/golang.org/x/text/internal/gen/code.go
deleted file mode 100644
index 0389509..0000000
--- a/vendor/golang.org/x/text/internal/gen/code.go
+++ /dev/null
@@ -1,369 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package gen
-
-import (
- "bytes"
- "encoding/gob"
- "fmt"
- "hash"
- "hash/fnv"
- "io"
- "log"
- "os"
- "reflect"
- "strings"
- "unicode"
- "unicode/utf8"
-)
-
-// This file contains utilities for generating code.
-
-// TODO: other write methods like:
-// - slices, maps, types, etc.
-
-// CodeWriter is a utility for writing structured code. It computes the content
-// hash and size of written content. It ensures there are newlines between
-// written code blocks.
-type CodeWriter struct {
- buf bytes.Buffer
- Size int
- Hash hash.Hash32 // content hash
- gob *gob.Encoder
- // For comments we skip the usual one-line separator if they are followed by
- // a code block.
- skipSep bool
-}
-
-func (w *CodeWriter) Write(p []byte) (n int, err error) {
- return w.buf.Write(p)
-}
-
-// NewCodeWriter returns a new CodeWriter.
-func NewCodeWriter() *CodeWriter {
- h := fnv.New32()
- return &CodeWriter{Hash: h, gob: gob.NewEncoder(h)}
-}
-
-// WriteGoFile appends the buffer with the total size of all created structures
-// and writes it as a Go file to the the given file with the given package name.
-func (w *CodeWriter) WriteGoFile(filename, pkg string) {
- f, err := os.Create(filename)
- if err != nil {
- log.Fatalf("Could not create file %s: %v", filename, err)
- }
- defer f.Close()
- if _, err = w.WriteGo(f, pkg, ""); err != nil {
- log.Fatalf("Error writing file %s: %v", filename, err)
- }
-}
-
-// WriteVersionedGoFile appends the buffer with the total size of all created
-// structures and writes it as a Go file to the the given file with the given
-// package name and build tags for the current Unicode version,
-func (w *CodeWriter) WriteVersionedGoFile(filename, pkg string) {
- tags := buildTags()
- if tags != "" {
- filename = insertVersion(filename, UnicodeVersion())
- }
- f, err := os.Create(filename)
- if err != nil {
- log.Fatalf("Could not create file %s: %v", filename, err)
- }
- defer f.Close()
- if _, err = w.WriteGo(f, pkg, tags); err != nil {
- log.Fatalf("Error writing file %s: %v", filename, err)
- }
-}
-
-// WriteGo appends the buffer with the total size of all created structures and
-// writes it as a Go file to the the given writer with the given package name.
-func (w *CodeWriter) WriteGo(out io.Writer, pkg, tags string) (n int, err error) {
- sz := w.Size
- w.WriteComment("Total table size %d bytes (%dKiB); checksum: %X\n", sz, sz/1024, w.Hash.Sum32())
- defer w.buf.Reset()
- return WriteGo(out, pkg, tags, w.buf.Bytes())
-}
-
-func (w *CodeWriter) printf(f string, x ...interface{}) {
- fmt.Fprintf(w, f, x...)
-}
-
-func (w *CodeWriter) insertSep() {
- if w.skipSep {
- w.skipSep = false
- return
- }
- // Use at least two newlines to ensure a blank space between the previous
- // block. WriteGoFile will remove extraneous newlines.
- w.printf("\n\n")
-}
-
-// WriteComment writes a comment block. All line starts are prefixed with "//".
-// Initial empty lines are gobbled. The indentation for the first line is
-// stripped from consecutive lines.
-func (w *CodeWriter) WriteComment(comment string, args ...interface{}) {
- s := fmt.Sprintf(comment, args...)
- s = strings.Trim(s, "\n")
-
- // Use at least two newlines to ensure a blank space between the previous
- // block. WriteGoFile will remove extraneous newlines.
- w.printf("\n\n// ")
- w.skipSep = true
-
- // strip first indent level.
- sep := "\n"
- for ; len(s) > 0 && (s[0] == '\t' || s[0] == ' '); s = s[1:] {
- sep += s[:1]
- }
-
- strings.NewReplacer(sep, "\n// ", "\n", "\n// ").WriteString(w, s)
-
- w.printf("\n")
-}
-
-func (w *CodeWriter) writeSizeInfo(size int) {
- w.printf("// Size: %d bytes\n", size)
-}
-
-// WriteConst writes a constant of the given name and value.
-func (w *CodeWriter) WriteConst(name string, x interface{}) {
- w.insertSep()
- v := reflect.ValueOf(x)
-
- switch v.Type().Kind() {
- case reflect.String:
- w.printf("const %s %s = ", name, typeName(x))
- w.WriteString(v.String())
- w.printf("\n")
- default:
- w.printf("const %s = %#v\n", name, x)
- }
-}
-
-// WriteVar writes a variable of the given name and value.
-func (w *CodeWriter) WriteVar(name string, x interface{}) {
- w.insertSep()
- v := reflect.ValueOf(x)
- oldSize := w.Size
- sz := int(v.Type().Size())
- w.Size += sz
-
- switch v.Type().Kind() {
- case reflect.String:
- w.printf("var %s %s = ", name, typeName(x))
- w.WriteString(v.String())
- case reflect.Struct:
- w.gob.Encode(x)
- fallthrough
- case reflect.Slice, reflect.Array:
- w.printf("var %s = ", name)
- w.writeValue(v)
- w.writeSizeInfo(w.Size - oldSize)
- default:
- w.printf("var %s %s = ", name, typeName(x))
- w.gob.Encode(x)
- w.writeValue(v)
- w.writeSizeInfo(w.Size - oldSize)
- }
- w.printf("\n")
-}
-
-func (w *CodeWriter) writeValue(v reflect.Value) {
- x := v.Interface()
- switch v.Kind() {
- case reflect.String:
- w.WriteString(v.String())
- case reflect.Array:
- // Don't double count: callers of WriteArray count on the size being
- // added, so we need to discount it here.
- w.Size -= int(v.Type().Size())
- w.writeSlice(x, true)
- case reflect.Slice:
- w.writeSlice(x, false)
- case reflect.Struct:
- w.printf("%s{\n", typeName(v.Interface()))
- t := v.Type()
- for i := 0; i < v.NumField(); i++ {
- w.printf("%s: ", t.Field(i).Name)
- w.writeValue(v.Field(i))
- w.printf(",\n")
- }
- w.printf("}")
- default:
- w.printf("%#v", x)
- }
-}
-
-// WriteString writes a string literal.
-func (w *CodeWriter) WriteString(s string) {
- s = strings.Replace(s, `\`, `\\`, -1)
- io.WriteString(w.Hash, s) // content hash
- w.Size += len(s)
-
- const maxInline = 40
- if len(s) <= maxInline {
- w.printf("%q", s)
- return
- }
-
- // We will render the string as a multi-line string.
- const maxWidth = 80 - 4 - len(`"`) - len(`" +`)
-
- // When starting on its own line, go fmt indents line 2+ an extra level.
- n, max := maxWidth, maxWidth-4
-
- // As per https://golang.org/issue/18078, the compiler has trouble
- // compiling the concatenation of many strings, s0 + s1 + s2 + ... + sN,
- // for large N. We insert redundant, explicit parentheses to work around
- // that, lowering the N at any given step: (s0 + s1 + ... + s63) + (s64 +
- // ... + s127) + etc + (etc + ... + sN).
- explicitParens, extraComment := len(s) > 128*1024, ""
- if explicitParens {
- w.printf(`(`)
- extraComment = "; the redundant, explicit parens are for https://golang.org/issue/18078"
- }
-
- // Print "" +\n, if a string does not start on its own line.
- b := w.buf.Bytes()
- if p := len(bytes.TrimRight(b, " \t")); p > 0 && b[p-1] != '\n' {
- w.printf("\"\" + // Size: %d bytes%s\n", len(s), extraComment)
- n, max = maxWidth, maxWidth
- }
-
- w.printf(`"`)
-
- for sz, p, nLines := 0, 0, 0; p < len(s); {
- var r rune
- r, sz = utf8.DecodeRuneInString(s[p:])
- out := s[p : p+sz]
- chars := 1
- if !unicode.IsPrint(r) || r == utf8.RuneError || r == '"' {
- switch sz {
- case 1:
- out = fmt.Sprintf("\\x%02x", s[p])
- case 2, 3:
- out = fmt.Sprintf("\\u%04x", r)
- case 4:
- out = fmt.Sprintf("\\U%08x", r)
- }
- chars = len(out)
- }
- if n -= chars; n < 0 {
- nLines++
- if explicitParens && nLines&63 == 63 {
- w.printf("\") + (\"")
- }
- w.printf("\" +\n\"")
- n = max - len(out)
- }
- w.printf("%s", out)
- p += sz
- }
- w.printf(`"`)
- if explicitParens {
- w.printf(`)`)
- }
-}
-
-// WriteSlice writes a slice value.
-func (w *CodeWriter) WriteSlice(x interface{}) {
- w.writeSlice(x, false)
-}
-
-// WriteArray writes an array value.
-func (w *CodeWriter) WriteArray(x interface{}) {
- w.writeSlice(x, true)
-}
-
-func (w *CodeWriter) writeSlice(x interface{}, isArray bool) {
- v := reflect.ValueOf(x)
- w.gob.Encode(v.Len())
- w.Size += v.Len() * int(v.Type().Elem().Size())
- name := typeName(x)
- if isArray {
- name = fmt.Sprintf("[%d]%s", v.Len(), name[strings.Index(name, "]")+1:])
- }
- if isArray {
- w.printf("%s{\n", name)
- } else {
- w.printf("%s{ // %d elements\n", name, v.Len())
- }
-
- switch kind := v.Type().Elem().Kind(); kind {
- case reflect.String:
- for _, s := range x.([]string) {
- w.WriteString(s)
- w.printf(",\n")
- }
- case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64,
- reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64:
- // nLine and nBlock are the number of elements per line and block.
- nLine, nBlock, format := 8, 64, "%d,"
- switch kind {
- case reflect.Uint8:
- format = "%#02x,"
- case reflect.Uint16:
- format = "%#04x,"
- case reflect.Uint32:
- nLine, nBlock, format = 4, 32, "%#08x,"
- case reflect.Uint, reflect.Uint64:
- nLine, nBlock, format = 4, 32, "%#016x,"
- case reflect.Int8:
- nLine = 16
- }
- n := nLine
- for i := 0; i < v.Len(); i++ {
- if i%nBlock == 0 && v.Len() > nBlock {
- w.printf("// Entry %X - %X\n", i, i+nBlock-1)
- }
- x := v.Index(i).Interface()
- w.gob.Encode(x)
- w.printf(format, x)
- if n--; n == 0 {
- n = nLine
- w.printf("\n")
- }
- }
- w.printf("\n")
- case reflect.Struct:
- zero := reflect.Zero(v.Type().Elem()).Interface()
- for i := 0; i < v.Len(); i++ {
- x := v.Index(i).Interface()
- w.gob.EncodeValue(v)
- if !reflect.DeepEqual(zero, x) {
- line := fmt.Sprintf("%#v,\n", x)
- line = line[strings.IndexByte(line, '{'):]
- w.printf("%d: ", i)
- w.printf(line)
- }
- }
- case reflect.Array:
- for i := 0; i < v.Len(); i++ {
- w.printf("%d: %#v,\n", i, v.Index(i).Interface())
- }
- default:
- panic("gen: slice elem type not supported")
- }
- w.printf("}")
-}
-
-// WriteType writes a definition of the type of the given value and returns the
-// type name.
-func (w *CodeWriter) WriteType(x interface{}) string {
- t := reflect.TypeOf(x)
- w.printf("type %s struct {\n", t.Name())
- for i := 0; i < t.NumField(); i++ {
- w.printf("\t%s %s\n", t.Field(i).Name, t.Field(i).Type)
- }
- w.printf("}\n")
- return t.Name()
-}
-
-// typeName returns the name of the go type of x.
-func typeName(x interface{}) string {
- t := reflect.ValueOf(x).Type()
- return strings.Replace(fmt.Sprint(t), "main.", "", 1)
-}
diff --git a/vendor/golang.org/x/text/internal/gen/gen.go b/vendor/golang.org/x/text/internal/gen/gen.go
deleted file mode 100644
index 4c3f760..0000000
--- a/vendor/golang.org/x/text/internal/gen/gen.go
+++ /dev/null
@@ -1,333 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package gen contains common code for the various code generation tools in the
-// text repository. Its usage ensures consistency between tools.
-//
-// This package defines command line flags that are common to most generation
-// tools. The flags allow for specifying specific Unicode and CLDR versions
-// in the public Unicode data repository (http://www.unicode.org/Public).
-//
-// A local Unicode data mirror can be set through the flag -local or the
-// environment variable UNICODE_DIR. The former takes precedence. The local
-// directory should follow the same structure as the public repository.
-//
-// IANA data can also optionally be mirrored by putting it in the iana directory
-// rooted at the top of the local mirror. Beware, though, that IANA data is not
-// versioned. So it is up to the developer to use the right version.
-package gen // import "golang.org/x/text/internal/gen"
-
-import (
- "bytes"
- "flag"
- "fmt"
- "go/build"
- "go/format"
- "io"
- "io/ioutil"
- "log"
- "net/http"
- "os"
- "path"
- "path/filepath"
- "strings"
- "sync"
- "unicode"
-
- "golang.org/x/text/unicode/cldr"
-)
-
-var (
- url = flag.String("url",
- "http://www.unicode.org/Public",
- "URL of Unicode database directory")
- iana = flag.String("iana",
- "http://www.iana.org",
- "URL of the IANA repository")
- unicodeVersion = flag.String("unicode",
- getEnv("UNICODE_VERSION", unicode.Version),
- "unicode version to use")
- cldrVersion = flag.String("cldr",
- getEnv("CLDR_VERSION", cldr.Version),
- "cldr version to use")
-)
-
-func getEnv(name, def string) string {
- if v := os.Getenv(name); v != "" {
- return v
- }
- return def
-}
-
-// Init performs common initialization for a gen command. It parses the flags
-// and sets up the standard logging parameters.
-func Init() {
- log.SetPrefix("")
- log.SetFlags(log.Lshortfile)
- flag.Parse()
-}
-
-const header = `// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-`
-
-// UnicodeVersion reports the requested Unicode version.
-func UnicodeVersion() string {
- return *unicodeVersion
-}
-
-// CLDRVersion reports the requested CLDR version.
-func CLDRVersion() string {
- return *cldrVersion
-}
-
-var tags = []struct{ version, buildTags string }{
- {"10.0.0", "go1.10"},
- {"", "!go1.10"},
-}
-
-// buildTags reports the build tags used for the current Unicode version.
-func buildTags() string {
- v := UnicodeVersion()
- for _, x := range tags {
- // We should do a numeric comparison, but including the collate package
- // would create an import cycle. We approximate it by assuming that
- // longer version strings are later.
- if len(x.version) <= len(v) {
- return x.buildTags
- }
- if len(x.version) == len(v) && x.version <= v {
- return x.buildTags
- }
- }
- return tags[0].buildTags
-}
-
-// IsLocal reports whether data files are available locally.
-func IsLocal() bool {
- dir, err := localReadmeFile()
- if err != nil {
- return false
- }
- if _, err = os.Stat(dir); err != nil {
- return false
- }
- return true
-}
-
-// OpenUCDFile opens the requested UCD file. The file is specified relative to
-// the public Unicode root directory. It will call log.Fatal if there are any
-// errors.
-func OpenUCDFile(file string) io.ReadCloser {
- return openUnicode(path.Join(*unicodeVersion, "ucd", file))
-}
-
-// OpenCLDRCoreZip opens the CLDR core zip file. It will call log.Fatal if there
-// are any errors.
-func OpenCLDRCoreZip() io.ReadCloser {
- return OpenUnicodeFile("cldr", *cldrVersion, "core.zip")
-}
-
-// OpenUnicodeFile opens the requested file of the requested category from the
-// root of the Unicode data archive. The file is specified relative to the
-// public Unicode root directory. If version is "", it will use the default
-// Unicode version. It will call log.Fatal if there are any errors.
-func OpenUnicodeFile(category, version, file string) io.ReadCloser {
- if version == "" {
- version = UnicodeVersion()
- }
- return openUnicode(path.Join(category, version, file))
-}
-
-// OpenIANAFile opens the requested IANA file. The file is specified relative
-// to the IANA root, which is typically either http://www.iana.org or the
-// iana directory in the local mirror. It will call log.Fatal if there are any
-// errors.
-func OpenIANAFile(path string) io.ReadCloser {
- return Open(*iana, "iana", path)
-}
-
-var (
- dirMutex sync.Mutex
- localDir string
-)
-
-const permissions = 0755
-
-func localReadmeFile() (string, error) {
- p, err := build.Import("golang.org/x/text", "", build.FindOnly)
- if err != nil {
- return "", fmt.Errorf("Could not locate package: %v", err)
- }
- return filepath.Join(p.Dir, "DATA", "README"), nil
-}
-
-func getLocalDir() string {
- dirMutex.Lock()
- defer dirMutex.Unlock()
-
- readme, err := localReadmeFile()
- if err != nil {
- log.Fatal(err)
- }
- dir := filepath.Dir(readme)
- if _, err := os.Stat(readme); err != nil {
- if err := os.MkdirAll(dir, permissions); err != nil {
- log.Fatalf("Could not create directory: %v", err)
- }
- ioutil.WriteFile(readme, []byte(readmeTxt), permissions)
- }
- return dir
-}
-
-const readmeTxt = `Generated by golang.org/x/text/internal/gen. DO NOT EDIT.
-
-This directory contains downloaded files used to generate the various tables
-in the golang.org/x/text subrepo.
-
-Note that the language subtag repo (iana/assignments/language-subtag-registry)
-and all other times in the iana subdirectory are not versioned and will need
-to be periodically manually updated. The easiest way to do this is to remove
-the entire iana directory. This is mostly of concern when updating the language
-package.
-`
-
-// Open opens subdir/path if a local directory is specified and the file exists,
-// where subdir is a directory relative to the local root, or fetches it from
-// urlRoot/path otherwise. It will call log.Fatal if there are any errors.
-func Open(urlRoot, subdir, path string) io.ReadCloser {
- file := filepath.Join(getLocalDir(), subdir, filepath.FromSlash(path))
- return open(file, urlRoot, path)
-}
-
-func openUnicode(path string) io.ReadCloser {
- file := filepath.Join(getLocalDir(), filepath.FromSlash(path))
- return open(file, *url, path)
-}
-
-// TODO: automatically periodically update non-versioned files.
-
-func open(file, urlRoot, path string) io.ReadCloser {
- if f, err := os.Open(file); err == nil {
- return f
- }
- r := get(urlRoot, path)
- defer r.Close()
- b, err := ioutil.ReadAll(r)
- if err != nil {
- log.Fatalf("Could not download file: %v", err)
- }
- os.MkdirAll(filepath.Dir(file), permissions)
- if err := ioutil.WriteFile(file, b, permissions); err != nil {
- log.Fatalf("Could not create file: %v", err)
- }
- return ioutil.NopCloser(bytes.NewReader(b))
-}
-
-func get(root, path string) io.ReadCloser {
- url := root + "/" + path
- fmt.Printf("Fetching %s...", url)
- defer fmt.Println(" done.")
- resp, err := http.Get(url)
- if err != nil {
- log.Fatalf("HTTP GET: %v", err)
- }
- if resp.StatusCode != 200 {
- log.Fatalf("Bad GET status for %q: %q", url, resp.Status)
- }
- return resp.Body
-}
-
-// TODO: use Write*Version in all applicable packages.
-
-// WriteUnicodeVersion writes a constant for the Unicode version from which the
-// tables are generated.
-func WriteUnicodeVersion(w io.Writer) {
- fmt.Fprintf(w, "// UnicodeVersion is the Unicode version from which the tables in this package are derived.\n")
- fmt.Fprintf(w, "const UnicodeVersion = %q\n\n", UnicodeVersion())
-}
-
-// WriteCLDRVersion writes a constant for the CLDR version from which the
-// tables are generated.
-func WriteCLDRVersion(w io.Writer) {
- fmt.Fprintf(w, "// CLDRVersion is the CLDR version from which the tables in this package are derived.\n")
- fmt.Fprintf(w, "const CLDRVersion = %q\n\n", CLDRVersion())
-}
-
-// WriteGoFile prepends a standard file comment and package statement to the
-// given bytes, applies gofmt, and writes them to a file with the given name.
-// It will call log.Fatal if there are any errors.
-func WriteGoFile(filename, pkg string, b []byte) {
- w, err := os.Create(filename)
- if err != nil {
- log.Fatalf("Could not create file %s: %v", filename, err)
- }
- defer w.Close()
- if _, err = WriteGo(w, pkg, "", b); err != nil {
- log.Fatalf("Error writing file %s: %v", filename, err)
- }
-}
-
-func insertVersion(filename, version string) string {
- suffix := ".go"
- if strings.HasSuffix(filename, "_test.go") {
- suffix = "_test.go"
- }
- return fmt.Sprint(filename[:len(filename)-len(suffix)], version, suffix)
-}
-
-// WriteVersionedGoFile prepends a standard file comment, adds build tags to
-// version the file for the current Unicode version, and package statement to
-// the given bytes, applies gofmt, and writes them to a file with the given
-// name. It will call log.Fatal if there are any errors.
-func WriteVersionedGoFile(filename, pkg string, b []byte) {
- tags := buildTags()
- if tags != "" {
- filename = insertVersion(filename, UnicodeVersion())
- }
- w, err := os.Create(filename)
- if err != nil {
- log.Fatalf("Could not create file %s: %v", filename, err)
- }
- defer w.Close()
- if _, err = WriteGo(w, pkg, tags, b); err != nil {
- log.Fatalf("Error writing file %s: %v", filename, err)
- }
-}
-
-// WriteGo prepends a standard file comment and package statement to the given
-// bytes, applies gofmt, and writes them to w.
-func WriteGo(w io.Writer, pkg, tags string, b []byte) (n int, err error) {
- src := []byte(header)
- if tags != "" {
- src = append(src, fmt.Sprintf("// +build %s\n\n", tags)...)
- }
- src = append(src, fmt.Sprintf("package %s\n\n", pkg)...)
- src = append(src, b...)
- formatted, err := format.Source(src)
- if err != nil {
- // Print the generated code even in case of an error so that the
- // returned error can be meaningfully interpreted.
- n, _ = w.Write(src)
- return n, err
- }
- return w.Write(formatted)
-}
-
-// Repackage rewrites a Go file from belonging to package main to belonging to
-// the given package.
-func Repackage(inFile, outFile, pkg string) {
- src, err := ioutil.ReadFile(inFile)
- if err != nil {
- log.Fatalf("reading %s: %v", inFile, err)
- }
- const toDelete = "package main\n\n"
- i := bytes.Index(src, []byte(toDelete))
- if i < 0 {
- log.Fatalf("Could not find %q in %s.", toDelete, inFile)
- }
- w := &bytes.Buffer{}
- w.Write(src[i+len(toDelete):])
- WriteGoFile(outFile, pkg, w.Bytes())
-}
diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/internal/language/common.go
index 9d86e18..cdfdb74 100644
--- a/vendor/golang.org/x/text/language/common.go
+++ b/vendor/golang.org/x/text/internal/language/common.go
@@ -4,13 +4,13 @@ package language
// This file contains code common to the maketables.go and the package code.
-// langAliasType is the type of an alias in langAliasMap.
-type langAliasType int8
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
const (
- langDeprecated langAliasType = iota
- langMacro
- langLegacy
+ Deprecated AliasType = iota
+ Macro
+ Legacy
- langAliasTypeUnknown langAliasType = -1
+ AliasTypeUnknown AliasType = -1
)
diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go
new file mode 100644
index 0000000..46a0015
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact.go
@@ -0,0 +1,29 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// CompactCoreInfo is a compact integer with the three core tags encoded.
+type CompactCoreInfo uint32
+
+// GetCompactCore generates a uint32 value that is guaranteed to be unique for
+// different language, region, and script values.
+func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) {
+ if t.LangID > langNoIndexOffset {
+ return 0, false
+ }
+ cci |= CompactCoreInfo(t.LangID) << (8 + 12)
+ cci |= CompactCoreInfo(t.ScriptID) << 12
+ cci |= CompactCoreInfo(t.RegionID)
+ return cci, true
+}
+
+// Tag generates a tag from c.
+func (c CompactCoreInfo) Tag() Tag {
+ return Tag{
+ LangID: Language(c >> 20),
+ RegionID: Region(c & 0x3ff),
+ ScriptID: Script(c>>12) & 0xff,
+ }
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go
new file mode 100644
index 0000000..1b36935
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/compact.go
@@ -0,0 +1,61 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package compact defines a compact representation of language tags.
+//
+// Common language tags (at least all for which locale information is defined
+// in CLDR) are assigned a unique index. Each Tag is associated with such an
+// ID for selecting language-related resources (such as translations) as well
+// as one for selecting regional defaults (currency, number formatting, etc.)
+//
+// It may want to export this functionality at some point, but at this point
+// this is only available for use within x/text.
+package compact // import "golang.org/x/text/internal/language/compact"
+
+import (
+ "sort"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// ID is an integer identifying a single tag.
+type ID uint16
+
+func getCoreIndex(t language.Tag) (id ID, ok bool) {
+ cci, ok := language.GetCompactCore(t)
+ if !ok {
+ return 0, false
+ }
+ i := sort.Search(len(coreTags), func(i int) bool {
+ return cci <= coreTags[i]
+ })
+ if i == len(coreTags) || coreTags[i] != cci {
+ return 0, false
+ }
+ return ID(i), true
+}
+
+// Parent returns the ID of the parent or the root ID if id is already the root.
+func (id ID) Parent() ID {
+ return parents[id]
+}
+
+// Tag converts id to an internal language Tag.
+func (id ID) Tag() language.Tag {
+ if int(id) >= len(coreTags) {
+ return specialTags[int(id)-len(coreTags)]
+ }
+ return coreTags[id].Tag()
+}
+
+var specialTags []language.Tag
+
+func init() {
+ tags := strings.Split(specialTagsStr, " ")
+ specialTags = make([]language.Tag, len(tags))
+ for i, t := range tags {
+ specialTags[i] = language.MustParse(t)
+ }
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go
new file mode 100644
index 0000000..83816a7
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/language.go
@@ -0,0 +1,260 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_index.go -output tables.go
+//go:generate go run gen_parents.go
+
+package compact
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag struct {
+ // NOTE: exported tags will become part of the public API.
+ language ID
+ locale ID
+ full fullTag // always a language.Tag for now.
+}
+
+const _und = 0
+
+type fullTag interface {
+ IsRoot() bool
+ Parent() language.Tag
+}
+
+// Make a compact Tag from a fully specified internal language Tag.
+func Make(t language.Tag) (tag Tag) {
+ if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" {
+ if r, err := language.ParseRegion(region[:2]); err == nil {
+ tFull := t
+ t, _ = t.SetTypeForKey("rg", "")
+ // TODO: should we not consider "va" for the language tag?
+ var exact1, exact2 bool
+ tag.language, exact1 = FromTag(t)
+ t.RegionID = r
+ tag.locale, exact2 = FromTag(t)
+ if !exact1 || !exact2 {
+ tag.full = tFull
+ }
+ return tag
+ }
+ }
+ lang, ok := FromTag(t)
+ tag.language = lang
+ tag.locale = lang
+ if !ok {
+ tag.full = t
+ }
+ return tag
+}
+
+// Tag returns an internal language Tag version of this tag.
+func (t Tag) Tag() language.Tag {
+ if t.full != nil {
+ return t.full.(language.Tag)
+ }
+ tag := t.language.Tag()
+ if t.language != t.locale {
+ loc := t.locale.Tag()
+ tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz")
+ }
+ return tag
+}
+
+// IsCompact reports whether this tag is fully defined in terms of ID.
+func (t *Tag) IsCompact() bool {
+ return t.full == nil
+}
+
+// MayHaveVariants reports whether a tag may have variants. If it returns false
+// it is guaranteed the tag does not have variants.
+func (t Tag) MayHaveVariants() bool {
+ return t.full != nil || int(t.language) >= len(coreTags)
+}
+
+// MayHaveExtensions reports whether a tag may have extensions. If it returns
+// false it is guaranteed the tag does not have them.
+func (t Tag) MayHaveExtensions() bool {
+ return t.full != nil ||
+ int(t.language) >= len(coreTags) ||
+ t.language != t.locale
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ if t.full != nil {
+ return t.full.IsRoot()
+ }
+ return t.language == _und
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+ if t.full != nil {
+ return Make(t.full.Parent())
+ }
+ if t.language != t.locale {
+ // Simulate stripping -u-rg-xxxxxx
+ return Tag{language: t.language, locale: t.language}
+ }
+ // TODO: use parent lookup table once cycle from internal package is
+ // removed. Probably by internalizing the table and declaring this fast
+ // enough.
+ // lang := compactID(internal.Parent(uint16(t.language)))
+ lang, _ := FromTag(t.language.Tag().Parent())
+ return Tag{language: lang, locale: lang}
+}
+
+// returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+ p := strings.Index(s[1:], "-")
+ if p == -1 {
+ return s[1:], ""
+ }
+ p++
+ return s[1:p], s[p:]
+}
+
+// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func LanguageID(t Tag) (id ID, exact bool) {
+ return t.language, t.full == nil
+}
+
+// RegionalID returns the ID for the regional variant of this tag. This index is
+// used to indicate region-specific overrides, such as default currency, default
+// calendar and week data, default time cycle, and default measurement system
+// and unit preferences.
+//
+// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US
+// settings for currency, number formatting, etc. The CompactIndex for this tag
+// will be that for en-GB, while the RegionalID will be the one corresponding to
+// en-US.
+func RegionalID(t Tag) (id ID, exact bool) {
+ return t.locale, t.full == nil
+}
+
+// LanguageTag returns t stripped of regional variant indicators.
+//
+// At the moment this means it is stripped of a regional and variant subtag "rg"
+// and "va" in the "u" extension.
+func (t Tag) LanguageTag() Tag {
+ if t.full == nil {
+ return Tag{language: t.language, locale: t.language}
+ }
+ tt := t.Tag()
+ tt.SetTypeForKey("rg", "")
+ tt.SetTypeForKey("va", "")
+ return Make(tt)
+}
+
+// RegionalTag returns the regional variant of the tag.
+//
+// At the moment this means that the region is set from the regional subtag
+// "rg" in the "u" extension.
+func (t Tag) RegionalTag() Tag {
+ rt := Tag{language: t.locale, locale: t.locale}
+ if t.full == nil {
+ return rt
+ }
+ b := language.Builder{}
+ tag := t.Tag()
+ // tag, _ = tag.SetTypeForKey("rg", "")
+ b.SetTag(t.locale.Tag())
+ if v := tag.Variants(); v != "" {
+ for _, v := range strings.Split(v, "-") {
+ b.AddVariant(v)
+ }
+ }
+ for _, e := range tag.Extensions() {
+ b.AddExt(e)
+ }
+ return t
+}
+
+// FromTag reports closest matching ID for an internal language Tag.
+func FromTag(t language.Tag) (id ID, exact bool) {
+ // TODO: perhaps give more frequent tags a lower index.
+ // TODO: we could make the indexes stable. This will excluded some
+ // possibilities for optimization, so don't do this quite yet.
+ exact = true
+
+ b, s, r := t.Raw()
+ if t.HasString() {
+ if t.IsPrivateUse() {
+ // We have no entries for user-defined tags.
+ return 0, false
+ }
+ hasExtra := false
+ if t.HasVariants() {
+ if t.HasExtensions() {
+ build := language.Builder{}
+ build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r})
+ build.AddVariant(t.Variants())
+ exact = false
+ t = build.Make()
+ }
+ hasExtra = true
+ } else if _, ok := t.Extension('u'); ok {
+ // TODO: va may mean something else. Consider not considering it.
+ // Strip all but the 'va' entry.
+ old := t
+ variant := t.TypeForKey("va")
+ t = language.Tag{LangID: b, ScriptID: s, RegionID: r}
+ if variant != "" {
+ t, _ = t.SetTypeForKey("va", variant)
+ hasExtra = true
+ }
+ exact = old == t
+ } else {
+ exact = false
+ }
+ if hasExtra {
+ // We have some variants.
+ for i, s := range specialTags {
+ if s == t {
+ return ID(i + len(coreTags)), exact
+ }
+ }
+ exact = false
+ }
+ }
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ exact = false
+ if r != 0 && s == 0 {
+ // Deal with cases where an extra script is inserted for the region.
+ t, _ := t.Maximize()
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ }
+ for t = t.Parent(); t != root; t = t.Parent() {
+ // No variants specified: just compare core components.
+ // The key has the form lllssrrr, where l, s, and r are nibbles for
+ // respectively the langID, scriptID, and regionID.
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ }
+ return 0, exact
+}
+
+var root = language.Tag{}
diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go
new file mode 100644
index 0000000..8d81072
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/parents.go
@@ -0,0 +1,120 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+// parents maps a compact index of a tag to the compact index of the parent of
+// this tag.
+var parents = []ID{ // 775 elements
+ // Entry 0 - 3F
+ 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006,
+ 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000,
+ 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000,
+ 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000,
+ 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e,
+ // Entry 40 - 7F
+ 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046,
+ 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000,
+ 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000,
+ 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d,
+ 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066,
+ 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b,
+ 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000,
+ 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e,
+ // Entry 80 - BF
+ 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086,
+ 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087,
+ 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087,
+ 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086,
+ // Entry C0 - FF
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087,
+ 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087,
+ 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000,
+ 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2,
+ 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1,
+ // Entry 100 - 13F
+ 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1,
+ 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e,
+ 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000,
+ 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e,
+ 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ // Entry 140 - 17F
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156,
+ 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c,
+ 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000,
+ 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000,
+ 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176,
+ 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e,
+ // Entry 180 - 1BF
+ 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184,
+ 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e,
+ 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000,
+ 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000,
+ 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000,
+ 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000,
+ 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6,
+ 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000,
+ // Entry 1C0 - 1FF
+ 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000,
+ 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb,
+ 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000,
+ 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000,
+ 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6,
+ 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee,
+ 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5,
+ 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000,
+ // Entry 200 - 23F
+ 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000,
+ 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000,
+ 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000,
+ 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000,
+ 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226,
+ 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000,
+ 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236,
+ 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244,
+ // Entry 240 - 27F
+ 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000,
+ 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000,
+ 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254,
+ 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000,
+ 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000,
+ 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e,
+ 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273,
+ 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000,
+ // Entry 280 - 2BF
+ 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286,
+ 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000,
+ 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295,
+ 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d,
+ 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000,
+ 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae,
+ 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5,
+ 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000,
+ // Entry 2C0 - 2FF
+ 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000,
+ 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd,
+ 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000,
+ 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000,
+ 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6,
+ 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000,
+ 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000,
+ 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000,
+ // Entry 300 - 33F
+ 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6,
+} // Size: 1574 bytes
+
+// Total table size 1574 bytes (1KiB); checksum: 895AAF0B
diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go
new file mode 100644
index 0000000..554ca35
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tables.go
@@ -0,0 +1,1015 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+import "golang.org/x/text/internal/language"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+// NumCompactTags is the number of common tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = 775
+const (
+ undIndex ID = 0
+ afIndex ID = 1
+ afNAIndex ID = 2
+ afZAIndex ID = 3
+ agqIndex ID = 4
+ agqCMIndex ID = 5
+ akIndex ID = 6
+ akGHIndex ID = 7
+ amIndex ID = 8
+ amETIndex ID = 9
+ arIndex ID = 10
+ ar001Index ID = 11
+ arAEIndex ID = 12
+ arBHIndex ID = 13
+ arDJIndex ID = 14
+ arDZIndex ID = 15
+ arEGIndex ID = 16
+ arEHIndex ID = 17
+ arERIndex ID = 18
+ arILIndex ID = 19
+ arIQIndex ID = 20
+ arJOIndex ID = 21
+ arKMIndex ID = 22
+ arKWIndex ID = 23
+ arLBIndex ID = 24
+ arLYIndex ID = 25
+ arMAIndex ID = 26
+ arMRIndex ID = 27
+ arOMIndex ID = 28
+ arPSIndex ID = 29
+ arQAIndex ID = 30
+ arSAIndex ID = 31
+ arSDIndex ID = 32
+ arSOIndex ID = 33
+ arSSIndex ID = 34
+ arSYIndex ID = 35
+ arTDIndex ID = 36
+ arTNIndex ID = 37
+ arYEIndex ID = 38
+ arsIndex ID = 39
+ asIndex ID = 40
+ asINIndex ID = 41
+ asaIndex ID = 42
+ asaTZIndex ID = 43
+ astIndex ID = 44
+ astESIndex ID = 45
+ azIndex ID = 46
+ azCyrlIndex ID = 47
+ azCyrlAZIndex ID = 48
+ azLatnIndex ID = 49
+ azLatnAZIndex ID = 50
+ basIndex ID = 51
+ basCMIndex ID = 52
+ beIndex ID = 53
+ beBYIndex ID = 54
+ bemIndex ID = 55
+ bemZMIndex ID = 56
+ bezIndex ID = 57
+ bezTZIndex ID = 58
+ bgIndex ID = 59
+ bgBGIndex ID = 60
+ bhIndex ID = 61
+ bmIndex ID = 62
+ bmMLIndex ID = 63
+ bnIndex ID = 64
+ bnBDIndex ID = 65
+ bnINIndex ID = 66
+ boIndex ID = 67
+ boCNIndex ID = 68
+ boINIndex ID = 69
+ brIndex ID = 70
+ brFRIndex ID = 71
+ brxIndex ID = 72
+ brxINIndex ID = 73
+ bsIndex ID = 74
+ bsCyrlIndex ID = 75
+ bsCyrlBAIndex ID = 76
+ bsLatnIndex ID = 77
+ bsLatnBAIndex ID = 78
+ caIndex ID = 79
+ caADIndex ID = 80
+ caESIndex ID = 81
+ caFRIndex ID = 82
+ caITIndex ID = 83
+ ccpIndex ID = 84
+ ccpBDIndex ID = 85
+ ccpINIndex ID = 86
+ ceIndex ID = 87
+ ceRUIndex ID = 88
+ cggIndex ID = 89
+ cggUGIndex ID = 90
+ chrIndex ID = 91
+ chrUSIndex ID = 92
+ ckbIndex ID = 93
+ ckbIQIndex ID = 94
+ ckbIRIndex ID = 95
+ csIndex ID = 96
+ csCZIndex ID = 97
+ cuIndex ID = 98
+ cuRUIndex ID = 99
+ cyIndex ID = 100
+ cyGBIndex ID = 101
+ daIndex ID = 102
+ daDKIndex ID = 103
+ daGLIndex ID = 104
+ davIndex ID = 105
+ davKEIndex ID = 106
+ deIndex ID = 107
+ deATIndex ID = 108
+ deBEIndex ID = 109
+ deCHIndex ID = 110
+ deDEIndex ID = 111
+ deITIndex ID = 112
+ deLIIndex ID = 113
+ deLUIndex ID = 114
+ djeIndex ID = 115
+ djeNEIndex ID = 116
+ dsbIndex ID = 117
+ dsbDEIndex ID = 118
+ duaIndex ID = 119
+ duaCMIndex ID = 120
+ dvIndex ID = 121
+ dyoIndex ID = 122
+ dyoSNIndex ID = 123
+ dzIndex ID = 124
+ dzBTIndex ID = 125
+ ebuIndex ID = 126
+ ebuKEIndex ID = 127
+ eeIndex ID = 128
+ eeGHIndex ID = 129
+ eeTGIndex ID = 130
+ elIndex ID = 131
+ elCYIndex ID = 132
+ elGRIndex ID = 133
+ enIndex ID = 134
+ en001Index ID = 135
+ en150Index ID = 136
+ enAGIndex ID = 137
+ enAIIndex ID = 138
+ enASIndex ID = 139
+ enATIndex ID = 140
+ enAUIndex ID = 141
+ enBBIndex ID = 142
+ enBEIndex ID = 143
+ enBIIndex ID = 144
+ enBMIndex ID = 145
+ enBSIndex ID = 146
+ enBWIndex ID = 147
+ enBZIndex ID = 148
+ enCAIndex ID = 149
+ enCCIndex ID = 150
+ enCHIndex ID = 151
+ enCKIndex ID = 152
+ enCMIndex ID = 153
+ enCXIndex ID = 154
+ enCYIndex ID = 155
+ enDEIndex ID = 156
+ enDGIndex ID = 157
+ enDKIndex ID = 158
+ enDMIndex ID = 159
+ enERIndex ID = 160
+ enFIIndex ID = 161
+ enFJIndex ID = 162
+ enFKIndex ID = 163
+ enFMIndex ID = 164
+ enGBIndex ID = 165
+ enGDIndex ID = 166
+ enGGIndex ID = 167
+ enGHIndex ID = 168
+ enGIIndex ID = 169
+ enGMIndex ID = 170
+ enGUIndex ID = 171
+ enGYIndex ID = 172
+ enHKIndex ID = 173
+ enIEIndex ID = 174
+ enILIndex ID = 175
+ enIMIndex ID = 176
+ enINIndex ID = 177
+ enIOIndex ID = 178
+ enJEIndex ID = 179
+ enJMIndex ID = 180
+ enKEIndex ID = 181
+ enKIIndex ID = 182
+ enKNIndex ID = 183
+ enKYIndex ID = 184
+ enLCIndex ID = 185
+ enLRIndex ID = 186
+ enLSIndex ID = 187
+ enMGIndex ID = 188
+ enMHIndex ID = 189
+ enMOIndex ID = 190
+ enMPIndex ID = 191
+ enMSIndex ID = 192
+ enMTIndex ID = 193
+ enMUIndex ID = 194
+ enMWIndex ID = 195
+ enMYIndex ID = 196
+ enNAIndex ID = 197
+ enNFIndex ID = 198
+ enNGIndex ID = 199
+ enNLIndex ID = 200
+ enNRIndex ID = 201
+ enNUIndex ID = 202
+ enNZIndex ID = 203
+ enPGIndex ID = 204
+ enPHIndex ID = 205
+ enPKIndex ID = 206
+ enPNIndex ID = 207
+ enPRIndex ID = 208
+ enPWIndex ID = 209
+ enRWIndex ID = 210
+ enSBIndex ID = 211
+ enSCIndex ID = 212
+ enSDIndex ID = 213
+ enSEIndex ID = 214
+ enSGIndex ID = 215
+ enSHIndex ID = 216
+ enSIIndex ID = 217
+ enSLIndex ID = 218
+ enSSIndex ID = 219
+ enSXIndex ID = 220
+ enSZIndex ID = 221
+ enTCIndex ID = 222
+ enTKIndex ID = 223
+ enTOIndex ID = 224
+ enTTIndex ID = 225
+ enTVIndex ID = 226
+ enTZIndex ID = 227
+ enUGIndex ID = 228
+ enUMIndex ID = 229
+ enUSIndex ID = 230
+ enVCIndex ID = 231
+ enVGIndex ID = 232
+ enVIIndex ID = 233
+ enVUIndex ID = 234
+ enWSIndex ID = 235
+ enZAIndex ID = 236
+ enZMIndex ID = 237
+ enZWIndex ID = 238
+ eoIndex ID = 239
+ eo001Index ID = 240
+ esIndex ID = 241
+ es419Index ID = 242
+ esARIndex ID = 243
+ esBOIndex ID = 244
+ esBRIndex ID = 245
+ esBZIndex ID = 246
+ esCLIndex ID = 247
+ esCOIndex ID = 248
+ esCRIndex ID = 249
+ esCUIndex ID = 250
+ esDOIndex ID = 251
+ esEAIndex ID = 252
+ esECIndex ID = 253
+ esESIndex ID = 254
+ esGQIndex ID = 255
+ esGTIndex ID = 256
+ esHNIndex ID = 257
+ esICIndex ID = 258
+ esMXIndex ID = 259
+ esNIIndex ID = 260
+ esPAIndex ID = 261
+ esPEIndex ID = 262
+ esPHIndex ID = 263
+ esPRIndex ID = 264
+ esPYIndex ID = 265
+ esSVIndex ID = 266
+ esUSIndex ID = 267
+ esUYIndex ID = 268
+ esVEIndex ID = 269
+ etIndex ID = 270
+ etEEIndex ID = 271
+ euIndex ID = 272
+ euESIndex ID = 273
+ ewoIndex ID = 274
+ ewoCMIndex ID = 275
+ faIndex ID = 276
+ faAFIndex ID = 277
+ faIRIndex ID = 278
+ ffIndex ID = 279
+ ffCMIndex ID = 280
+ ffGNIndex ID = 281
+ ffMRIndex ID = 282
+ ffSNIndex ID = 283
+ fiIndex ID = 284
+ fiFIIndex ID = 285
+ filIndex ID = 286
+ filPHIndex ID = 287
+ foIndex ID = 288
+ foDKIndex ID = 289
+ foFOIndex ID = 290
+ frIndex ID = 291
+ frBEIndex ID = 292
+ frBFIndex ID = 293
+ frBIIndex ID = 294
+ frBJIndex ID = 295
+ frBLIndex ID = 296
+ frCAIndex ID = 297
+ frCDIndex ID = 298
+ frCFIndex ID = 299
+ frCGIndex ID = 300
+ frCHIndex ID = 301
+ frCIIndex ID = 302
+ frCMIndex ID = 303
+ frDJIndex ID = 304
+ frDZIndex ID = 305
+ frFRIndex ID = 306
+ frGAIndex ID = 307
+ frGFIndex ID = 308
+ frGNIndex ID = 309
+ frGPIndex ID = 310
+ frGQIndex ID = 311
+ frHTIndex ID = 312
+ frKMIndex ID = 313
+ frLUIndex ID = 314
+ frMAIndex ID = 315
+ frMCIndex ID = 316
+ frMFIndex ID = 317
+ frMGIndex ID = 318
+ frMLIndex ID = 319
+ frMQIndex ID = 320
+ frMRIndex ID = 321
+ frMUIndex ID = 322
+ frNCIndex ID = 323
+ frNEIndex ID = 324
+ frPFIndex ID = 325
+ frPMIndex ID = 326
+ frREIndex ID = 327
+ frRWIndex ID = 328
+ frSCIndex ID = 329
+ frSNIndex ID = 330
+ frSYIndex ID = 331
+ frTDIndex ID = 332
+ frTGIndex ID = 333
+ frTNIndex ID = 334
+ frVUIndex ID = 335
+ frWFIndex ID = 336
+ frYTIndex ID = 337
+ furIndex ID = 338
+ furITIndex ID = 339
+ fyIndex ID = 340
+ fyNLIndex ID = 341
+ gaIndex ID = 342
+ gaIEIndex ID = 343
+ gdIndex ID = 344
+ gdGBIndex ID = 345
+ glIndex ID = 346
+ glESIndex ID = 347
+ gswIndex ID = 348
+ gswCHIndex ID = 349
+ gswFRIndex ID = 350
+ gswLIIndex ID = 351
+ guIndex ID = 352
+ guINIndex ID = 353
+ guwIndex ID = 354
+ guzIndex ID = 355
+ guzKEIndex ID = 356
+ gvIndex ID = 357
+ gvIMIndex ID = 358
+ haIndex ID = 359
+ haGHIndex ID = 360
+ haNEIndex ID = 361
+ haNGIndex ID = 362
+ hawIndex ID = 363
+ hawUSIndex ID = 364
+ heIndex ID = 365
+ heILIndex ID = 366
+ hiIndex ID = 367
+ hiINIndex ID = 368
+ hrIndex ID = 369
+ hrBAIndex ID = 370
+ hrHRIndex ID = 371
+ hsbIndex ID = 372
+ hsbDEIndex ID = 373
+ huIndex ID = 374
+ huHUIndex ID = 375
+ hyIndex ID = 376
+ hyAMIndex ID = 377
+ idIndex ID = 378
+ idIDIndex ID = 379
+ igIndex ID = 380
+ igNGIndex ID = 381
+ iiIndex ID = 382
+ iiCNIndex ID = 383
+ inIndex ID = 384
+ ioIndex ID = 385
+ isIndex ID = 386
+ isISIndex ID = 387
+ itIndex ID = 388
+ itCHIndex ID = 389
+ itITIndex ID = 390
+ itSMIndex ID = 391
+ itVAIndex ID = 392
+ iuIndex ID = 393
+ iwIndex ID = 394
+ jaIndex ID = 395
+ jaJPIndex ID = 396
+ jboIndex ID = 397
+ jgoIndex ID = 398
+ jgoCMIndex ID = 399
+ jiIndex ID = 400
+ jmcIndex ID = 401
+ jmcTZIndex ID = 402
+ jvIndex ID = 403
+ jwIndex ID = 404
+ kaIndex ID = 405
+ kaGEIndex ID = 406
+ kabIndex ID = 407
+ kabDZIndex ID = 408
+ kajIndex ID = 409
+ kamIndex ID = 410
+ kamKEIndex ID = 411
+ kcgIndex ID = 412
+ kdeIndex ID = 413
+ kdeTZIndex ID = 414
+ keaIndex ID = 415
+ keaCVIndex ID = 416
+ khqIndex ID = 417
+ khqMLIndex ID = 418
+ kiIndex ID = 419
+ kiKEIndex ID = 420
+ kkIndex ID = 421
+ kkKZIndex ID = 422
+ kkjIndex ID = 423
+ kkjCMIndex ID = 424
+ klIndex ID = 425
+ klGLIndex ID = 426
+ klnIndex ID = 427
+ klnKEIndex ID = 428
+ kmIndex ID = 429
+ kmKHIndex ID = 430
+ knIndex ID = 431
+ knINIndex ID = 432
+ koIndex ID = 433
+ koKPIndex ID = 434
+ koKRIndex ID = 435
+ kokIndex ID = 436
+ kokINIndex ID = 437
+ ksIndex ID = 438
+ ksINIndex ID = 439
+ ksbIndex ID = 440
+ ksbTZIndex ID = 441
+ ksfIndex ID = 442
+ ksfCMIndex ID = 443
+ kshIndex ID = 444
+ kshDEIndex ID = 445
+ kuIndex ID = 446
+ kwIndex ID = 447
+ kwGBIndex ID = 448
+ kyIndex ID = 449
+ kyKGIndex ID = 450
+ lagIndex ID = 451
+ lagTZIndex ID = 452
+ lbIndex ID = 453
+ lbLUIndex ID = 454
+ lgIndex ID = 455
+ lgUGIndex ID = 456
+ lktIndex ID = 457
+ lktUSIndex ID = 458
+ lnIndex ID = 459
+ lnAOIndex ID = 460
+ lnCDIndex ID = 461
+ lnCFIndex ID = 462
+ lnCGIndex ID = 463
+ loIndex ID = 464
+ loLAIndex ID = 465
+ lrcIndex ID = 466
+ lrcIQIndex ID = 467
+ lrcIRIndex ID = 468
+ ltIndex ID = 469
+ ltLTIndex ID = 470
+ luIndex ID = 471
+ luCDIndex ID = 472
+ luoIndex ID = 473
+ luoKEIndex ID = 474
+ luyIndex ID = 475
+ luyKEIndex ID = 476
+ lvIndex ID = 477
+ lvLVIndex ID = 478
+ masIndex ID = 479
+ masKEIndex ID = 480
+ masTZIndex ID = 481
+ merIndex ID = 482
+ merKEIndex ID = 483
+ mfeIndex ID = 484
+ mfeMUIndex ID = 485
+ mgIndex ID = 486
+ mgMGIndex ID = 487
+ mghIndex ID = 488
+ mghMZIndex ID = 489
+ mgoIndex ID = 490
+ mgoCMIndex ID = 491
+ mkIndex ID = 492
+ mkMKIndex ID = 493
+ mlIndex ID = 494
+ mlINIndex ID = 495
+ mnIndex ID = 496
+ mnMNIndex ID = 497
+ moIndex ID = 498
+ mrIndex ID = 499
+ mrINIndex ID = 500
+ msIndex ID = 501
+ msBNIndex ID = 502
+ msMYIndex ID = 503
+ msSGIndex ID = 504
+ mtIndex ID = 505
+ mtMTIndex ID = 506
+ muaIndex ID = 507
+ muaCMIndex ID = 508
+ myIndex ID = 509
+ myMMIndex ID = 510
+ mznIndex ID = 511
+ mznIRIndex ID = 512
+ nahIndex ID = 513
+ naqIndex ID = 514
+ naqNAIndex ID = 515
+ nbIndex ID = 516
+ nbNOIndex ID = 517
+ nbSJIndex ID = 518
+ ndIndex ID = 519
+ ndZWIndex ID = 520
+ ndsIndex ID = 521
+ ndsDEIndex ID = 522
+ ndsNLIndex ID = 523
+ neIndex ID = 524
+ neINIndex ID = 525
+ neNPIndex ID = 526
+ nlIndex ID = 527
+ nlAWIndex ID = 528
+ nlBEIndex ID = 529
+ nlBQIndex ID = 530
+ nlCWIndex ID = 531
+ nlNLIndex ID = 532
+ nlSRIndex ID = 533
+ nlSXIndex ID = 534
+ nmgIndex ID = 535
+ nmgCMIndex ID = 536
+ nnIndex ID = 537
+ nnNOIndex ID = 538
+ nnhIndex ID = 539
+ nnhCMIndex ID = 540
+ noIndex ID = 541
+ nqoIndex ID = 542
+ nrIndex ID = 543
+ nsoIndex ID = 544
+ nusIndex ID = 545
+ nusSSIndex ID = 546
+ nyIndex ID = 547
+ nynIndex ID = 548
+ nynUGIndex ID = 549
+ omIndex ID = 550
+ omETIndex ID = 551
+ omKEIndex ID = 552
+ orIndex ID = 553
+ orINIndex ID = 554
+ osIndex ID = 555
+ osGEIndex ID = 556
+ osRUIndex ID = 557
+ paIndex ID = 558
+ paArabIndex ID = 559
+ paArabPKIndex ID = 560
+ paGuruIndex ID = 561
+ paGuruINIndex ID = 562
+ papIndex ID = 563
+ plIndex ID = 564
+ plPLIndex ID = 565
+ prgIndex ID = 566
+ prg001Index ID = 567
+ psIndex ID = 568
+ psAFIndex ID = 569
+ ptIndex ID = 570
+ ptAOIndex ID = 571
+ ptBRIndex ID = 572
+ ptCHIndex ID = 573
+ ptCVIndex ID = 574
+ ptGQIndex ID = 575
+ ptGWIndex ID = 576
+ ptLUIndex ID = 577
+ ptMOIndex ID = 578
+ ptMZIndex ID = 579
+ ptPTIndex ID = 580
+ ptSTIndex ID = 581
+ ptTLIndex ID = 582
+ quIndex ID = 583
+ quBOIndex ID = 584
+ quECIndex ID = 585
+ quPEIndex ID = 586
+ rmIndex ID = 587
+ rmCHIndex ID = 588
+ rnIndex ID = 589
+ rnBIIndex ID = 590
+ roIndex ID = 591
+ roMDIndex ID = 592
+ roROIndex ID = 593
+ rofIndex ID = 594
+ rofTZIndex ID = 595
+ ruIndex ID = 596
+ ruBYIndex ID = 597
+ ruKGIndex ID = 598
+ ruKZIndex ID = 599
+ ruMDIndex ID = 600
+ ruRUIndex ID = 601
+ ruUAIndex ID = 602
+ rwIndex ID = 603
+ rwRWIndex ID = 604
+ rwkIndex ID = 605
+ rwkTZIndex ID = 606
+ sahIndex ID = 607
+ sahRUIndex ID = 608
+ saqIndex ID = 609
+ saqKEIndex ID = 610
+ sbpIndex ID = 611
+ sbpTZIndex ID = 612
+ sdIndex ID = 613
+ sdPKIndex ID = 614
+ sdhIndex ID = 615
+ seIndex ID = 616
+ seFIIndex ID = 617
+ seNOIndex ID = 618
+ seSEIndex ID = 619
+ sehIndex ID = 620
+ sehMZIndex ID = 621
+ sesIndex ID = 622
+ sesMLIndex ID = 623
+ sgIndex ID = 624
+ sgCFIndex ID = 625
+ shIndex ID = 626
+ shiIndex ID = 627
+ shiLatnIndex ID = 628
+ shiLatnMAIndex ID = 629
+ shiTfngIndex ID = 630
+ shiTfngMAIndex ID = 631
+ siIndex ID = 632
+ siLKIndex ID = 633
+ skIndex ID = 634
+ skSKIndex ID = 635
+ slIndex ID = 636
+ slSIIndex ID = 637
+ smaIndex ID = 638
+ smiIndex ID = 639
+ smjIndex ID = 640
+ smnIndex ID = 641
+ smnFIIndex ID = 642
+ smsIndex ID = 643
+ snIndex ID = 644
+ snZWIndex ID = 645
+ soIndex ID = 646
+ soDJIndex ID = 647
+ soETIndex ID = 648
+ soKEIndex ID = 649
+ soSOIndex ID = 650
+ sqIndex ID = 651
+ sqALIndex ID = 652
+ sqMKIndex ID = 653
+ sqXKIndex ID = 654
+ srIndex ID = 655
+ srCyrlIndex ID = 656
+ srCyrlBAIndex ID = 657
+ srCyrlMEIndex ID = 658
+ srCyrlRSIndex ID = 659
+ srCyrlXKIndex ID = 660
+ srLatnIndex ID = 661
+ srLatnBAIndex ID = 662
+ srLatnMEIndex ID = 663
+ srLatnRSIndex ID = 664
+ srLatnXKIndex ID = 665
+ ssIndex ID = 666
+ ssyIndex ID = 667
+ stIndex ID = 668
+ svIndex ID = 669
+ svAXIndex ID = 670
+ svFIIndex ID = 671
+ svSEIndex ID = 672
+ swIndex ID = 673
+ swCDIndex ID = 674
+ swKEIndex ID = 675
+ swTZIndex ID = 676
+ swUGIndex ID = 677
+ syrIndex ID = 678
+ taIndex ID = 679
+ taINIndex ID = 680
+ taLKIndex ID = 681
+ taMYIndex ID = 682
+ taSGIndex ID = 683
+ teIndex ID = 684
+ teINIndex ID = 685
+ teoIndex ID = 686
+ teoKEIndex ID = 687
+ teoUGIndex ID = 688
+ tgIndex ID = 689
+ tgTJIndex ID = 690
+ thIndex ID = 691
+ thTHIndex ID = 692
+ tiIndex ID = 693
+ tiERIndex ID = 694
+ tiETIndex ID = 695
+ tigIndex ID = 696
+ tkIndex ID = 697
+ tkTMIndex ID = 698
+ tlIndex ID = 699
+ tnIndex ID = 700
+ toIndex ID = 701
+ toTOIndex ID = 702
+ trIndex ID = 703
+ trCYIndex ID = 704
+ trTRIndex ID = 705
+ tsIndex ID = 706
+ ttIndex ID = 707
+ ttRUIndex ID = 708
+ twqIndex ID = 709
+ twqNEIndex ID = 710
+ tzmIndex ID = 711
+ tzmMAIndex ID = 712
+ ugIndex ID = 713
+ ugCNIndex ID = 714
+ ukIndex ID = 715
+ ukUAIndex ID = 716
+ urIndex ID = 717
+ urINIndex ID = 718
+ urPKIndex ID = 719
+ uzIndex ID = 720
+ uzArabIndex ID = 721
+ uzArabAFIndex ID = 722
+ uzCyrlIndex ID = 723
+ uzCyrlUZIndex ID = 724
+ uzLatnIndex ID = 725
+ uzLatnUZIndex ID = 726
+ vaiIndex ID = 727
+ vaiLatnIndex ID = 728
+ vaiLatnLRIndex ID = 729
+ vaiVaiiIndex ID = 730
+ vaiVaiiLRIndex ID = 731
+ veIndex ID = 732
+ viIndex ID = 733
+ viVNIndex ID = 734
+ voIndex ID = 735
+ vo001Index ID = 736
+ vunIndex ID = 737
+ vunTZIndex ID = 738
+ waIndex ID = 739
+ waeIndex ID = 740
+ waeCHIndex ID = 741
+ woIndex ID = 742
+ woSNIndex ID = 743
+ xhIndex ID = 744
+ xogIndex ID = 745
+ xogUGIndex ID = 746
+ yavIndex ID = 747
+ yavCMIndex ID = 748
+ yiIndex ID = 749
+ yi001Index ID = 750
+ yoIndex ID = 751
+ yoBJIndex ID = 752
+ yoNGIndex ID = 753
+ yueIndex ID = 754
+ yueHansIndex ID = 755
+ yueHansCNIndex ID = 756
+ yueHantIndex ID = 757
+ yueHantHKIndex ID = 758
+ zghIndex ID = 759
+ zghMAIndex ID = 760
+ zhIndex ID = 761
+ zhHansIndex ID = 762
+ zhHansCNIndex ID = 763
+ zhHansHKIndex ID = 764
+ zhHansMOIndex ID = 765
+ zhHansSGIndex ID = 766
+ zhHantIndex ID = 767
+ zhHantHKIndex ID = 768
+ zhHantMOIndex ID = 769
+ zhHantTWIndex ID = 770
+ zuIndex ID = 771
+ zuZAIndex ID = 772
+ caESvalenciaIndex ID = 773
+ enUSuvaposixIndex ID = 774
+)
+
+var coreTags = []language.CompactCoreInfo{ // 773 elements
+ // Entry 0 - 1F
+ 0x00000000, 0x01600000, 0x016000d2, 0x01600161,
+ 0x01c00000, 0x01c00052, 0x02100000, 0x02100080,
+ 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001,
+ 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067,
+ 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097,
+ 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac,
+ 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9,
+ 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108,
+ // Entry 20 - 3F
+ 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c,
+ 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000,
+ 0x04300000, 0x04300099, 0x04400000, 0x0440012f,
+ 0x04800000, 0x0480006e, 0x05800000, 0x0581f000,
+ 0x0581f032, 0x05857000, 0x05857032, 0x05e00000,
+ 0x05e00052, 0x07100000, 0x07100047, 0x07500000,
+ 0x07500162, 0x07900000, 0x0790012f, 0x07e00000,
+ 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3,
+ // Entry 40 - 5F
+ 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000,
+ 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078,
+ 0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000,
+ 0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000,
+ 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e,
+ 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000,
+ 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000,
+ 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c,
+ // Entry 60 - 7F
+ 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106,
+ 0x10000000, 0x1000007b, 0x10100000, 0x10100063,
+ 0x10100082, 0x10800000, 0x108000a4, 0x10d00000,
+ 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060,
+ 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000,
+ 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000,
+ 0x12400052, 0x12800000, 0x12b00000, 0x12b00114,
+ 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4,
+ // Entry 80 - 9F
+ 0x13000000, 0x13000080, 0x13000122, 0x13600000,
+ 0x1360005d, 0x13600087, 0x13900000, 0x13900001,
+ 0x1390001a, 0x13900025, 0x13900026, 0x1390002d,
+ 0x1390002e, 0x1390002f, 0x13900034, 0x13900036,
+ 0x1390003a, 0x1390003d, 0x13900042, 0x13900046,
+ 0x13900048, 0x13900049, 0x1390004a, 0x1390004e,
+ 0x13900050, 0x13900052, 0x1390005c, 0x1390005d,
+ 0x13900060, 0x13900061, 0x13900063, 0x13900064,
+ // Entry A0 - BF
+ 0x1390006d, 0x13900072, 0x13900073, 0x13900074,
+ 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f,
+ 0x13900080, 0x13900081, 0x13900083, 0x1390008a,
+ 0x1390008c, 0x1390008d, 0x13900096, 0x13900097,
+ 0x13900098, 0x13900099, 0x1390009a, 0x1390009f,
+ 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9,
+ 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5,
+ 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7,
+ // Entry C0 - DF
+ 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce,
+ 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6,
+ 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0,
+ 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb,
+ 0x139000ec, 0x139000f0, 0x13900107, 0x13900109,
+ 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d,
+ 0x1390010e, 0x1390010f, 0x13900112, 0x13900117,
+ 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125,
+ // Entry E0 - FF
+ 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f,
+ 0x13900131, 0x13900133, 0x13900135, 0x13900139,
+ 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142,
+ 0x13900161, 0x13900162, 0x13900164, 0x13c00000,
+ 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c,
+ 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051,
+ 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065,
+ 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086,
+ // Entry 100 - 11F
+ 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf,
+ 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7,
+ 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135,
+ 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a,
+ 0x14500000, 0x1450006e, 0x14600000, 0x14600052,
+ 0x14800000, 0x14800024, 0x1480009c, 0x14e00000,
+ 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114,
+ 0x15100000, 0x15100072, 0x15300000, 0x153000e7,
+ // Entry 120 - 13F
+ 0x15800000, 0x15800063, 0x15800076, 0x15e00000,
+ 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b,
+ 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c,
+ 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052,
+ 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a,
+ 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086,
+ 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba,
+ 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3,
+ // Entry 140 - 15F
+ 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3,
+ 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102,
+ 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c,
+ 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f,
+ 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e,
+ 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096,
+ 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e,
+ 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2,
+ // Entry 160 - 17F
+ 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000,
+ 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000,
+ 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000,
+ 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000,
+ 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090,
+ 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092,
+ 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095,
+ 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053,
+ // Entry 180 - 19F
+ 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d,
+ 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113,
+ 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000,
+ 0x200000a2, 0x20300000, 0x20700000, 0x20700052,
+ 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000,
+ 0x20f00000, 0x21000000, 0x2100007d, 0x21200000,
+ 0x21200067, 0x21600000, 0x21700000, 0x217000a4,
+ 0x21f00000, 0x22300000, 0x2230012f, 0x22700000,
+ // Entry 1A0 - 1BF
+ 0x2270005a, 0x23400000, 0x234000c3, 0x23900000,
+ 0x239000a4, 0x24200000, 0x242000ae, 0x24400000,
+ 0x24400052, 0x24500000, 0x24500082, 0x24600000,
+ 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000,
+ 0x25100099, 0x25400000, 0x254000aa, 0x254000ab,
+ 0x25600000, 0x25600099, 0x26a00000, 0x26a00099,
+ 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052,
+ 0x26e00000, 0x26e00060, 0x27400000, 0x28100000,
+ // Entry 1C0 - 1DF
+ 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000,
+ 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000,
+ 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000,
+ 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d,
+ 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b,
+ 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000,
+ 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000,
+ 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000,
+ // Entry 1E0 - 1FF
+ 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4,
+ 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf,
+ 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052,
+ 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099,
+ 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000,
+ 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0,
+ 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000,
+ 0x32500052, 0x33100000, 0x331000c4, 0x33a00000,
+ // Entry 200 - 21F
+ 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2,
+ 0x34700000, 0x347000da, 0x34700110, 0x34e00000,
+ 0x34e00164, 0x35000000, 0x35000060, 0x350000d9,
+ 0x35100000, 0x35100099, 0x351000db, 0x36700000,
+ 0x36700030, 0x36700036, 0x36700040, 0x3670005b,
+ 0x367000d9, 0x36700116, 0x3670011b, 0x36800000,
+ 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000,
+ 0x36c00052, 0x36f00000, 0x37500000, 0x37600000,
+ // Entry 220 - 23F
+ 0x37a00000, 0x38000000, 0x38000117, 0x38700000,
+ 0x38900000, 0x38900131, 0x39000000, 0x3900006f,
+ 0x390000a4, 0x39500000, 0x39500099, 0x39800000,
+ 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000,
+ 0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000,
+ 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001,
+ 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a,
+ 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086,
+ // Entry 240 - 25F
+ 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1,
+ 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000,
+ 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000,
+ 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000,
+ 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f,
+ 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae,
+ 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000,
+ 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000,
+ // Entry 260 - 27F
+ 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000,
+ 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000,
+ 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c,
+ 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3,
+ 0x40200000, 0x4020004c, 0x40700000, 0x40800000,
+ 0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba,
+ 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111,
+ 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000,
+ // Entry 280 - 29F
+ 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000,
+ 0x42300000, 0x42300164, 0x42900000, 0x42900062,
+ 0x4290006f, 0x429000a4, 0x42900115, 0x43100000,
+ 0x43100027, 0x431000c2, 0x4310014d, 0x43200000,
+ 0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105,
+ 0x4321f14d, 0x43257000, 0x43257033, 0x432570bd,
+ 0x43257105, 0x4325714d, 0x43700000, 0x43a00000,
+ 0x43b00000, 0x44400000, 0x44400031, 0x44400072,
+ // Entry 2A0 - 2BF
+ 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4,
+ 0x4450012f, 0x44500131, 0x44e00000, 0x45000000,
+ 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d,
+ 0x46100000, 0x46100099, 0x46400000, 0x464000a4,
+ 0x46400131, 0x46700000, 0x46700124, 0x46b00000,
+ 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f,
+ 0x47100000, 0x47600000, 0x47600127, 0x47a00000,
+ 0x48000000, 0x48200000, 0x48200129, 0x48a00000,
+ // Entry 2C0 - 2DF
+ 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000,
+ 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000,
+ 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000,
+ 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8,
+ 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000,
+ 0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000,
+ 0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4,
+ 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000,
+ // Entry 2E0 - 2FF
+ 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000,
+ 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114,
+ 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000,
+ 0x50900052, 0x51200000, 0x51200001, 0x51800000,
+ 0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000,
+ 0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000,
+ 0x528000ba, 0x52900000, 0x52938000, 0x52938053,
+ 0x5293808d, 0x529380c6, 0x5293810d, 0x52939000,
+ // Entry 300 - 31F
+ 0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000,
+ 0x52f00161,
+} // Size: 3116 bytes
+
+const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix"
+
+// Total table size 3147 bytes (3KiB); checksum: F4E57D15
diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go
new file mode 100644
index 0000000..ca135d2
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tags.go
@@ -0,0 +1,91 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package compact
+
+var (
+ und = Tag{}
+
+ Und Tag = Tag{}
+
+ Afrikaans Tag = Tag{language: afIndex, locale: afIndex}
+ Amharic Tag = Tag{language: amIndex, locale: amIndex}
+ Arabic Tag = Tag{language: arIndex, locale: arIndex}
+ ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index}
+ Azerbaijani Tag = Tag{language: azIndex, locale: azIndex}
+ Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex}
+ Bengali Tag = Tag{language: bnIndex, locale: bnIndex}
+ Catalan Tag = Tag{language: caIndex, locale: caIndex}
+ Czech Tag = Tag{language: csIndex, locale: csIndex}
+ Danish Tag = Tag{language: daIndex, locale: daIndex}
+ German Tag = Tag{language: deIndex, locale: deIndex}
+ Greek Tag = Tag{language: elIndex, locale: elIndex}
+ English Tag = Tag{language: enIndex, locale: enIndex}
+ AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex}
+ BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex}
+ Spanish Tag = Tag{language: esIndex, locale: esIndex}
+ EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex}
+ LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index}
+ Estonian Tag = Tag{language: etIndex, locale: etIndex}
+ Persian Tag = Tag{language: faIndex, locale: faIndex}
+ Finnish Tag = Tag{language: fiIndex, locale: fiIndex}
+ Filipino Tag = Tag{language: filIndex, locale: filIndex}
+ French Tag = Tag{language: frIndex, locale: frIndex}
+ CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex}
+ Gujarati Tag = Tag{language: guIndex, locale: guIndex}
+ Hebrew Tag = Tag{language: heIndex, locale: heIndex}
+ Hindi Tag = Tag{language: hiIndex, locale: hiIndex}
+ Croatian Tag = Tag{language: hrIndex, locale: hrIndex}
+ Hungarian Tag = Tag{language: huIndex, locale: huIndex}
+ Armenian Tag = Tag{language: hyIndex, locale: hyIndex}
+ Indonesian Tag = Tag{language: idIndex, locale: idIndex}
+ Icelandic Tag = Tag{language: isIndex, locale: isIndex}
+ Italian Tag = Tag{language: itIndex, locale: itIndex}
+ Japanese Tag = Tag{language: jaIndex, locale: jaIndex}
+ Georgian Tag = Tag{language: kaIndex, locale: kaIndex}
+ Kazakh Tag = Tag{language: kkIndex, locale: kkIndex}
+ Khmer Tag = Tag{language: kmIndex, locale: kmIndex}
+ Kannada Tag = Tag{language: knIndex, locale: knIndex}
+ Korean Tag = Tag{language: koIndex, locale: koIndex}
+ Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex}
+ Lao Tag = Tag{language: loIndex, locale: loIndex}
+ Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex}
+ Latvian Tag = Tag{language: lvIndex, locale: lvIndex}
+ Macedonian Tag = Tag{language: mkIndex, locale: mkIndex}
+ Malayalam Tag = Tag{language: mlIndex, locale: mlIndex}
+ Mongolian Tag = Tag{language: mnIndex, locale: mnIndex}
+ Marathi Tag = Tag{language: mrIndex, locale: mrIndex}
+ Malay Tag = Tag{language: msIndex, locale: msIndex}
+ Burmese Tag = Tag{language: myIndex, locale: myIndex}
+ Nepali Tag = Tag{language: neIndex, locale: neIndex}
+ Dutch Tag = Tag{language: nlIndex, locale: nlIndex}
+ Norwegian Tag = Tag{language: noIndex, locale: noIndex}
+ Punjabi Tag = Tag{language: paIndex, locale: paIndex}
+ Polish Tag = Tag{language: plIndex, locale: plIndex}
+ Portuguese Tag = Tag{language: ptIndex, locale: ptIndex}
+ BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex}
+ EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex}
+ Romanian Tag = Tag{language: roIndex, locale: roIndex}
+ Russian Tag = Tag{language: ruIndex, locale: ruIndex}
+ Sinhala Tag = Tag{language: siIndex, locale: siIndex}
+ Slovak Tag = Tag{language: skIndex, locale: skIndex}
+ Slovenian Tag = Tag{language: slIndex, locale: slIndex}
+ Albanian Tag = Tag{language: sqIndex, locale: sqIndex}
+ Serbian Tag = Tag{language: srIndex, locale: srIndex}
+ SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex}
+ Swedish Tag = Tag{language: svIndex, locale: svIndex}
+ Swahili Tag = Tag{language: swIndex, locale: swIndex}
+ Tamil Tag = Tag{language: taIndex, locale: taIndex}
+ Telugu Tag = Tag{language: teIndex, locale: teIndex}
+ Thai Tag = Tag{language: thIndex, locale: thIndex}
+ Turkish Tag = Tag{language: trIndex, locale: trIndex}
+ Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex}
+ Urdu Tag = Tag{language: urIndex, locale: urIndex}
+ Uzbek Tag = Tag{language: uzIndex, locale: uzIndex}
+ Vietnamese Tag = Tag{language: viIndex, locale: viIndex}
+ Chinese Tag = Tag{language: zhIndex, locale: zhIndex}
+ SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex}
+ TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex}
+ Zulu Tag = Tag{language: zuIndex, locale: zuIndex}
+)
diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go
new file mode 100644
index 0000000..4ae78e0
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compose.go
@@ -0,0 +1,167 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "sort"
+ "strings"
+)
+
+// A Builder allows constructing a Tag from individual components.
+// Its main user is Compose in the top-level language package.
+type Builder struct {
+ Tag Tag
+
+ private string // the x extension
+ variants []string
+ extensions []string
+}
+
+// Make returns a new Tag from the current settings.
+func (b *Builder) Make() Tag {
+ t := b.Tag
+
+ if len(b.extensions) > 0 || len(b.variants) > 0 {
+ sort.Sort(sortVariants(b.variants))
+ sort.Strings(b.extensions)
+
+ if b.private != "" {
+ b.extensions = append(b.extensions, b.private)
+ }
+ n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...)
+ buf := make([]byte, n)
+ p := t.genCoreBytes(buf)
+ t.pVariant = byte(p)
+ p += appendTokens(buf[p:], b.variants...)
+ t.pExt = uint16(p)
+ p += appendTokens(buf[p:], b.extensions...)
+ t.str = string(buf[:p])
+ // We may not always need to remake the string, but when or when not
+ // to do so is rather tricky.
+ scan := makeScanner(buf[:p])
+ t, _ = parse(&scan, "")
+ return t
+
+ } else if b.private != "" {
+ t.str = b.private
+ t.RemakeString()
+ }
+ return t
+}
+
+// SetTag copies all the settings from a given Tag. Any previously set values
+// are discarded.
+func (b *Builder) SetTag(t Tag) {
+ b.Tag.LangID = t.LangID
+ b.Tag.RegionID = t.RegionID
+ b.Tag.ScriptID = t.ScriptID
+ // TODO: optimize
+ b.variants = b.variants[:0]
+ if variants := t.Variants(); variants != "" {
+ for _, vr := range strings.Split(variants[1:], "-") {
+ b.variants = append(b.variants, vr)
+ }
+ }
+ b.extensions, b.private = b.extensions[:0], ""
+ for _, e := range t.Extensions() {
+ b.AddExt(e)
+ }
+}
+
+// AddExt adds extension e to the tag. e must be a valid extension as returned
+// by Tag.Extension. If the extension already exists, it will be discarded,
+// except for a -u extension, where non-existing key-type pairs will added.
+func (b *Builder) AddExt(e string) {
+ if e[0] == 'x' {
+ if b.private == "" {
+ b.private = e
+ }
+ return
+ }
+ for i, s := range b.extensions {
+ if s[0] == e[0] {
+ if e[0] == 'u' {
+ b.extensions[i] += e[1:]
+ }
+ return
+ }
+ }
+ b.extensions = append(b.extensions, e)
+}
+
+// SetExt sets the extension e to the tag. e must be a valid extension as
+// returned by Tag.Extension. If the extension already exists, it will be
+// overwritten, except for a -u extension, where the individual key-type pairs
+// will be set.
+func (b *Builder) SetExt(e string) {
+ if e[0] == 'x' {
+ b.private = e
+ return
+ }
+ for i, s := range b.extensions {
+ if s[0] == e[0] {
+ if e[0] == 'u' {
+ b.extensions[i] = e + s[1:]
+ } else {
+ b.extensions[i] = e
+ }
+ return
+ }
+ }
+ b.extensions = append(b.extensions, e)
+}
+
+// AddVariant adds any number of variants.
+func (b *Builder) AddVariant(v ...string) {
+ for _, v := range v {
+ if v != "" {
+ b.variants = append(b.variants, v)
+ }
+ }
+}
+
+// ClearVariants removes any variants previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearVariants() {
+ b.variants = b.variants[:0]
+}
+
+// ClearExtensions removes any extensions previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearExtensions() {
+ b.private = ""
+ b.extensions = b.extensions[:0]
+}
+
+func tokenLen(token ...string) (n int) {
+ for _, t := range token {
+ n += len(t) + 1
+ }
+ return
+}
+
+func appendTokens(b []byte, token ...string) int {
+ p := 0
+ for _, t := range token {
+ b[p] = '-'
+ copy(b[p+1:], t)
+ p += 1 + len(t)
+ }
+ return p
+}
+
+type sortVariants []string
+
+func (s sortVariants) Len() int {
+ return len(s)
+}
+
+func (s sortVariants) Swap(i, j int) {
+ s[j], s[i] = s[i], s[j]
+}
+
+func (s sortVariants) Less(i, j int) bool {
+ return variantIndex[s[i]] < variantIndex[s[j]]
+}
diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go
new file mode 100644
index 0000000..9b20b88
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/coverage.go
@@ -0,0 +1,28 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func BaseLanguages() []Language {
+ base := make([]Language, 0, NumLanguages)
+ for i := 0; i < langNoIndexOffset; i++ {
+ // We included "und" already for the value 0.
+ if i != nonCanonicalUnd {
+ base = append(base, Language(i))
+ }
+ }
+ i := langNoIndexOffset
+ for _, v := range langNoIndex {
+ for k := 0; k < 8; k++ {
+ if v&1 == 1 {
+ base = append(base, Language(i))
+ }
+ v >>= 1
+ i++
+ }
+ }
+ return base
+}
diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go
new file mode 100644
index 0000000..1e74d1a
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/language.go
@@ -0,0 +1,596 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_common.go -output tables.go
+
+package language // import "golang.org/x/text/internal/language"
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "errors"
+ "fmt"
+ "strings"
+)
+
+const (
+ // maxCoreSize is the maximum size of a BCP 47 tag without variants and
+ // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
+ maxCoreSize = 12
+
+ // max99thPercentileSize is a somewhat arbitrary buffer size that presumably
+ // is large enough to hold at least 99% of the BCP 47 tags.
+ max99thPercentileSize = 32
+
+ // maxSimpleUExtensionSize is the maximum size of a -u extension with one
+ // key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
+ maxSimpleUExtensionSize = 14
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed. The zero value of Tag is Und.
+type Tag struct {
+ // TODO: the following fields have the form TagTypeID. This name is chosen
+ // to allow refactoring the public package without conflicting with its
+ // Base, Script, and Region methods. Once the transition is fully completed
+ // the ID can be stripped from the name.
+
+ LangID Language
+ RegionID Region
+ // TODO: we will soon run out of positions for ScriptID. Idea: instead of
+ // storing lang, region, and ScriptID codes, store only the compact index and
+ // have a lookup table from this code to its expansion. This greatly speeds
+ // up table lookup, speed up common variant cases.
+ // This will also immediately free up 3 extra bytes. Also, the pVariant
+ // field can now be moved to the lookup table, as the compact index uniquely
+ // determines the offset of a possible variant.
+ ScriptID Script
+ pVariant byte // offset in str, includes preceding '-'
+ pExt uint16 // offset of first extension, includes preceding '-'
+
+ // str is the string representation of the Tag. It will only be used if the
+ // tag has variants or extensions.
+ str string
+}
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+ t, _ := Parse(s)
+ return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+// TODO: consider removing
+func (t Tag) Raw() (b Language, s Script, r Region) {
+ return t.LangID, t.ScriptID, t.RegionID
+}
+
+// equalTags compares language, script and region subtags only.
+func (t Tag) equalTags(a Tag) bool {
+ return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ if int(t.pVariant) < len(t.str) {
+ return false
+ }
+ return t.equalTags(Und)
+}
+
+// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use
+// tag.
+func (t Tag) IsPrivateUse() bool {
+ return t.str != "" && t.pVariant == 0
+}
+
+// RemakeString is used to update t.str in case lang, script or region changed.
+// It is assumed that pExt and pVariant still point to the start of the
+// respective parts.
+func (t *Tag) RemakeString() {
+ if t.str == "" {
+ return
+ }
+ extra := t.str[t.pVariant:]
+ if t.pVariant > 0 {
+ extra = extra[1:]
+ }
+ if t.equalTags(Und) && strings.HasPrefix(extra, "x-") {
+ t.str = extra
+ t.pVariant = 0
+ t.pExt = 0
+ return
+ }
+ var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
+ b := buf[:t.genCoreBytes(buf[:])]
+ if extra != "" {
+ diff := len(b) - int(t.pVariant)
+ b = append(b, '-')
+ b = append(b, extra...)
+ t.pVariant = uint8(int(t.pVariant) + diff)
+ t.pExt = uint16(int(t.pExt) + diff)
+ } else {
+ t.pVariant = uint8(len(b))
+ t.pExt = uint16(len(b))
+ }
+ t.str = string(b)
+}
+
+// genCoreBytes writes a string for the base languages, script and region tags
+// to the given buffer and returns the number of bytes written. It will never
+// write more than maxCoreSize bytes.
+func (t *Tag) genCoreBytes(buf []byte) int {
+ n := t.LangID.StringToBuf(buf[:])
+ if t.ScriptID != 0 {
+ n += copy(buf[n:], "-")
+ n += copy(buf[n:], t.ScriptID.String())
+ }
+ if t.RegionID != 0 {
+ n += copy(buf[n:], "-")
+ n += copy(buf[n:], t.RegionID.String())
+ }
+ return n
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+ if t.str != "" {
+ return t.str
+ }
+ if t.ScriptID == 0 && t.RegionID == 0 {
+ return t.LangID.String()
+ }
+ buf := [maxCoreSize]byte{}
+ return string(buf[:t.genCoreBytes(buf[:])])
+}
+
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+ if t.str != "" {
+ text = append(text, t.str...)
+ } else if t.ScriptID == 0 && t.RegionID == 0 {
+ text = append(text, t.LangID.String()...)
+ } else {
+ buf := [maxCoreSize]byte{}
+ text = buf[:t.genCoreBytes(buf[:])]
+ }
+ return text, nil
+}
+
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+ tag, err := Parse(string(text))
+ *t = tag
+ return err
+}
+
+// Variants returns the part of the tag holding all variants or the empty string
+// if there are no variants defined.
+func (t Tag) Variants() string {
+ if t.pVariant == 0 {
+ return ""
+ }
+ return t.str[t.pVariant:t.pExt]
+}
+
+// VariantOrPrivateUseTags returns variants or private use tags.
+func (t Tag) VariantOrPrivateUseTags() string {
+ if t.pExt > 0 {
+ return t.str[t.pVariant:t.pExt]
+ }
+ return t.str[t.pVariant:]
+}
+
+// HasString reports whether this tag defines more than just the raw
+// components.
+func (t Tag) HasString() bool {
+ return t.str != ""
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+ if t.str != "" {
+ // Strip the variants and extensions.
+ b, s, r := t.Raw()
+ t = Tag{LangID: b, ScriptID: s, RegionID: r}
+ if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 {
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID == t.ScriptID {
+ return Tag{LangID: t.LangID}
+ }
+ }
+ return t
+ }
+ if t.LangID != 0 {
+ if t.RegionID != 0 {
+ maxScript := t.ScriptID
+ if maxScript == 0 {
+ max, _ := addTags(t)
+ maxScript = max.ScriptID
+ }
+
+ for i := range parents {
+ if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript {
+ for _, r := range parents[i].fromRegion {
+ if Region(r) == t.RegionID {
+ return Tag{
+ LangID: t.LangID,
+ ScriptID: Script(parents[i].script),
+ RegionID: Region(parents[i].toRegion),
+ }
+ }
+ }
+ }
+ }
+
+ // Strip the script if it is the default one.
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID != maxScript {
+ return Tag{LangID: t.LangID, ScriptID: maxScript}
+ }
+ return Tag{LangID: t.LangID}
+ } else if t.ScriptID != 0 {
+ // The parent for an base-script pair with a non-default script is
+ // "und" instead of the base language.
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID != t.ScriptID {
+ return Und
+ }
+ return Tag{LangID: t.LangID}
+ }
+ }
+ return Und
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (ext string, err error) {
+ scan := makeScannerString(s)
+ var end int
+ if n := len(scan.token); n != 1 {
+ return "", ErrSyntax
+ }
+ scan.toLower(0, len(scan.b))
+ end = parseExtension(&scan)
+ if end != len(s) {
+ return "", ErrSyntax
+ }
+ return string(scan.b), nil
+}
+
+// HasVariants reports whether t has variants.
+func (t Tag) HasVariants() bool {
+ return uint16(t.pVariant) < t.pExt
+}
+
+// HasExtensions reports whether t has extensions.
+func (t Tag) HasExtensions() bool {
+ return int(t.pExt) < len(t.str)
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext string, ok bool) {
+ for i := int(t.pExt); i < len(t.str)-1; {
+ var ext string
+ i, ext = getExtension(t.str, i)
+ if ext[0] == x {
+ return ext, true
+ }
+ }
+ return "", false
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []string {
+ e := []string{}
+ for i := int(t.pExt); i < len(t.str)-1; {
+ var ext string
+ i, ext = getExtension(t.str, i)
+ e = append(e, ext)
+ }
+ return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+func (t Tag) TypeForKey(key string) string {
+ if start, end, _ := t.findTypeForKey(key); end != start {
+ return t.str[start:end]
+ }
+ return ""
+}
+
+var (
+ errPrivateUse = errors.New("cannot set a key on a private use tag")
+ errInvalidArguments = errors.New("invalid key or type")
+)
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+ if t.IsPrivateUse() {
+ return t, errPrivateUse
+ }
+ if len(key) != 2 {
+ return t, errInvalidArguments
+ }
+
+ // Remove the setting if value is "".
+ if value == "" {
+ start, end, _ := t.findTypeForKey(key)
+ if start != end {
+ // Remove key tag and leading '-'.
+ start -= 4
+
+ // Remove a possible empty extension.
+ if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
+ start -= 2
+ }
+ if start == int(t.pVariant) && end == len(t.str) {
+ t.str = ""
+ t.pVariant, t.pExt = 0, 0
+ } else {
+ t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
+ }
+ }
+ return t, nil
+ }
+
+ if len(value) < 3 || len(value) > 8 {
+ return t, errInvalidArguments
+ }
+
+ var (
+ buf [maxCoreSize + maxSimpleUExtensionSize]byte
+ uStart int // start of the -u extension.
+ )
+
+ // Generate the tag string if needed.
+ if t.str == "" {
+ uStart = t.genCoreBytes(buf[:])
+ buf[uStart] = '-'
+ uStart++
+ }
+
+ // Create new key-type pair and parse it to verify.
+ b := buf[uStart:]
+ copy(b, "u-")
+ copy(b[2:], key)
+ b[4] = '-'
+ b = b[:5+copy(b[5:], value)]
+ scan := makeScanner(b)
+ if parseExtensions(&scan); scan.err != nil {
+ return t, scan.err
+ }
+
+ // Assemble the replacement string.
+ if t.str == "" {
+ t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
+ t.str = string(buf[:uStart+len(b)])
+ } else {
+ s := t.str
+ start, end, hasExt := t.findTypeForKey(key)
+ if start == end {
+ if hasExt {
+ b = b[2:]
+ }
+ t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
+ } else {
+ t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
+ }
+ }
+ return t, nil
+}
+
+// findKeyAndType returns the start and end position for the type corresponding
+// to key or the point at which to insert the key-value pair if the type
+// wasn't found. The hasExt return value reports whether an -u extension was present.
+// Note: the extensions are typically very small and are likely to contain
+// only one key-type pair.
+func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
+ p := int(t.pExt)
+ if len(key) != 2 || p == len(t.str) || p == 0 {
+ return p, p, false
+ }
+ s := t.str
+
+ // Find the correct extension.
+ for p++; s[p] != 'u'; p++ {
+ if s[p] > 'u' {
+ p--
+ return p, p, false
+ }
+ if p = nextExtension(s, p); p == len(s) {
+ return len(s), len(s), false
+ }
+ }
+ // Proceed to the hyphen following the extension name.
+ p++
+
+ // curKey is the key currently being processed.
+ curKey := ""
+
+ // Iterate over keys until we get the end of a section.
+ for {
+ // p points to the hyphen preceding the current token.
+ if p3 := p + 3; s[p3] == '-' {
+ // Found a key.
+ // Check whether we just processed the key that was requested.
+ if curKey == key {
+ return start, p, true
+ }
+ // Set to the next key and continue scanning type tokens.
+ curKey = s[p+1 : p3]
+ if curKey > key {
+ return p, p, true
+ }
+ // Start of the type token sequence.
+ start = p + 4
+ // A type is at least 3 characters long.
+ p += 7 // 4 + 3
+ } else {
+ // Attribute or type, which is at least 3 characters long.
+ p += 4
+ }
+ // p points past the third character of a type or attribute.
+ max := p + 5 // maximum length of token plus hyphen.
+ if len(s) < max {
+ max = len(s)
+ }
+ for ; p < max && s[p] != '-'; p++ {
+ }
+ // Bail if we have exhausted all tokens or if the next token starts
+ // a new extension.
+ if p == len(s) || s[p+2] == '-' {
+ if curKey == key {
+ return start, p, true
+ }
+ return p, p, true
+ }
+ }
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (Language, error) {
+ if n := len(s); n < 2 || 3 < n {
+ return 0, ErrSyntax
+ }
+ var buf [3]byte
+ return getLangID(buf[:copy(buf[:], s)])
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (Script, error) {
+ if len(s) != 4 {
+ return 0, ErrSyntax
+ }
+ var buf [4]byte
+ return getScriptID(script, buf[:copy(buf[:], s)])
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+ return getRegionM49(r)
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (Region, error) {
+ if n := len(s); n < 2 || 3 < n {
+ return 0, ErrSyntax
+ }
+ var buf [3]byte
+ return getRegionID(buf[:copy(buf[:], s)])
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+ if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK {
+ return false
+ }
+ return true
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+ if r == 0 {
+ return false
+ }
+ return int(regionInclusion[r]) < len(regionContainment)
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+ if r == c {
+ return true
+ }
+ g := regionInclusion[r]
+ if g >= nRegionGroups {
+ return false
+ }
+ m := regionContainment[g]
+
+ d := regionInclusion[c]
+ b := regionInclusionBits[d]
+
+ // A contained country may belong to multiple disjoint groups. Matching any
+ // of these indicates containment. If the contained region is a group, it
+ // must strictly be a subset.
+ if d >= nRegionGroups {
+ return b&m != 0
+ }
+ return b&^m == 0
+}
+
+var errNoTLD = errors.New("language: region is not a valid ccTLD")
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+ // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
+ // difference between ISO 3166-1 and IANA ccTLD.
+ if r == _GB {
+ r = _UK
+ }
+ if (r.typ() & ccTLD) == 0 {
+ return 0, errNoTLD
+ }
+ return r, nil
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+ if cr := normRegion(r); cr != 0 {
+ return cr
+ }
+ return r
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+ ID uint8
+ str string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (Variant, error) {
+ s = strings.ToLower(s)
+ if id, ok := variantIndex[s]; ok {
+ return Variant{id, s}, nil
+ }
+ return Variant{}, NewValueError([]byte(s))
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+ return v.str
+}
diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go
index 1d80ac3..6294b81 100644
--- a/vendor/golang.org/x/text/language/lookup.go
+++ b/vendor/golang.org/x/text/internal/language/lookup.go
@@ -17,11 +17,11 @@ import (
// if it could not be found.
func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
if !tag.FixCase(form, key) {
- return 0, errSyntax
+ return 0, ErrSyntax
}
i := idx.Index(key)
if i == -1 {
- return 0, mkErrInvalid(key)
+ return 0, NewValueError(key)
}
return i, nil
}
@@ -32,38 +32,45 @@ func searchUint(imap []uint16, key uint16) int {
})
}
-type langID uint16
+type Language uint16
// getLangID returns the langID of s if s is a canonical subtag
// or langUnknown if s is not a canonical subtag.
-func getLangID(s []byte) (langID, error) {
+func getLangID(s []byte) (Language, error) {
if len(s) == 2 {
return getLangISO2(s)
}
return getLangISO3(s)
}
+// TODO language normalization as well as the AliasMaps could be moved to the
+// higher level package, but it is a bit tricky to separate the generation.
+
+func (id Language) Canonicalize() (Language, AliasType) {
+ return normLang(id)
+}
+
// mapLang returns the mapped langID of id according to mapping m.
-func normLang(id langID) (langID, langAliasType) {
- k := sort.Search(len(langAliasMap), func(i int) bool {
- return langAliasMap[i].from >= uint16(id)
+func normLang(id Language) (Language, AliasType) {
+ k := sort.Search(len(AliasMap), func(i int) bool {
+ return AliasMap[i].From >= uint16(id)
})
- if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) {
- return langID(langAliasMap[k].to), langAliasTypes[k]
+ if k < len(AliasMap) && AliasMap[k].From == uint16(id) {
+ return Language(AliasMap[k].To), AliasTypes[k]
}
- return id, langAliasTypeUnknown
+ return id, AliasTypeUnknown
}
// getLangISO2 returns the langID for the given 2-letter ISO language code
// or unknownLang if this does not exist.
-func getLangISO2(s []byte) (langID, error) {
+func getLangISO2(s []byte) (Language, error) {
if !tag.FixCase("zz", s) {
- return 0, errSyntax
+ return 0, ErrSyntax
}
if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
- return langID(i), nil
+ return Language(i), nil
}
- return 0, mkErrInvalid(s)
+ return 0, NewValueError(s)
}
const base = 'z' - 'a' + 1
@@ -88,7 +95,7 @@ func intToStr(v uint, s []byte) {
// getLangISO3 returns the langID for the given 3-letter ISO language code
// or unknownLang if this does not exist.
-func getLangISO3(s []byte) (langID, error) {
+func getLangISO3(s []byte) (Language, error) {
if tag.FixCase("und", s) {
// first try to match canonical 3-letter entries
for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
@@ -96,7 +103,7 @@ func getLangISO3(s []byte) (langID, error) {
// We treat "und" as special and always translate it to "unspecified".
// Note that ZZ and Zzzz are private use and are not treated as
// unspecified by default.
- id := langID(i)
+ id := Language(i)
if id == nonCanonicalUnd {
return 0, nil
}
@@ -104,26 +111,26 @@ func getLangISO3(s []byte) (langID, error) {
}
}
if i := altLangISO3.Index(s); i != -1 {
- return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil
+ return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil
}
n := strToInt(s)
if langNoIndex[n/8]&(1<<(n%8)) != 0 {
- return langID(n) + langNoIndexOffset, nil
+ return Language(n) + langNoIndexOffset, nil
}
// Check for non-canonical uses of ISO3.
for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
- return langID(i), nil
+ return Language(i), nil
}
}
- return 0, mkErrInvalid(s)
+ return 0, NewValueError(s)
}
- return 0, errSyntax
+ return 0, ErrSyntax
}
-// stringToBuf writes the string to b and returns the number of bytes
+// StringToBuf writes the string to b and returns the number of bytes
// written. cap(b) must be >= 3.
-func (id langID) stringToBuf(b []byte) int {
+func (id Language) StringToBuf(b []byte) int {
if id >= langNoIndexOffset {
intToStr(uint(id)-langNoIndexOffset, b[:3])
return 3
@@ -140,7 +147,7 @@ func (id langID) stringToBuf(b []byte) int {
// String returns the BCP 47 representation of the langID.
// Use b as variable name, instead of id, to ensure the variable
// used is consistent with that of Base in which this type is embedded.
-func (b langID) String() string {
+func (b Language) String() string {
if b == 0 {
return "und"
} else if b >= langNoIndexOffset {
@@ -157,7 +164,7 @@ func (b langID) String() string {
}
// ISO3 returns the ISO 639-3 language code.
-func (b langID) ISO3() string {
+func (b Language) ISO3() string {
if b == 0 || b >= langNoIndexOffset {
return b.String()
}
@@ -173,15 +180,24 @@ func (b langID) ISO3() string {
}
// IsPrivateUse reports whether this language code is reserved for private use.
-func (b langID) IsPrivateUse() bool {
+func (b Language) IsPrivateUse() bool {
return langPrivateStart <= b && b <= langPrivateEnd
}
-type regionID uint16
+// SuppressScript returns the script marked as SuppressScript in the IANA
+// language tag repository, or 0 if there is no such script.
+func (b Language) SuppressScript() Script {
+ if b < langNoIndexOffset {
+ return Script(suppressScript[b])
+ }
+ return 0
+}
+
+type Region uint16
// getRegionID returns the region id for s if s is a valid 2-letter region code
// or unknownRegion.
-func getRegionID(s []byte) (regionID, error) {
+func getRegionID(s []byte) (Region, error) {
if len(s) == 3 {
if isAlpha(s[0]) {
return getRegionISO3(s)
@@ -195,34 +211,34 @@ func getRegionID(s []byte) (regionID, error) {
// getRegionISO2 returns the regionID for the given 2-letter ISO country code
// or unknownRegion if this does not exist.
-func getRegionISO2(s []byte) (regionID, error) {
+func getRegionISO2(s []byte) (Region, error) {
i, err := findIndex(regionISO, s, "ZZ")
if err != nil {
return 0, err
}
- return regionID(i) + isoRegionOffset, nil
+ return Region(i) + isoRegionOffset, nil
}
// getRegionISO3 returns the regionID for the given 3-letter ISO country code
// or unknownRegion if this does not exist.
-func getRegionISO3(s []byte) (regionID, error) {
+func getRegionISO3(s []byte) (Region, error) {
if tag.FixCase("ZZZ", s) {
for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
- return regionID(i) + isoRegionOffset, nil
+ return Region(i) + isoRegionOffset, nil
}
}
for i := 0; i < len(altRegionISO3); i += 3 {
if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
- return regionID(altRegionIDs[i/3]), nil
+ return Region(altRegionIDs[i/3]), nil
}
}
- return 0, mkErrInvalid(s)
+ return 0, NewValueError(s)
}
- return 0, errSyntax
+ return 0, ErrSyntax
}
-func getRegionM49(n int) (regionID, error) {
+func getRegionM49(n int) (Region, error) {
if 0 < n && n <= 999 {
const (
searchBits = 7
@@ -236,7 +252,7 @@ func getRegionM49(n int) (regionID, error) {
return buf[i] >= val
})
if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
- return regionID(r & regionMask), nil
+ return Region(r & regionMask), nil
}
}
var e ValueError
@@ -247,13 +263,13 @@ func getRegionM49(n int) (regionID, error) {
// normRegion returns a region if r is deprecated or 0 otherwise.
// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
// TODO: consider mapping split up regions to new most populous one (like CLDR).
-func normRegion(r regionID) regionID {
+func normRegion(r Region) Region {
m := regionOldMap
k := sort.Search(len(m), func(i int) bool {
- return m[i].from >= uint16(r)
+ return m[i].From >= uint16(r)
})
- if k < len(m) && m[k].from == uint16(r) {
- return regionID(m[k].to)
+ if k < len(m) && m[k].From == uint16(r) {
+ return Region(m[k].To)
}
return 0
}
@@ -264,13 +280,13 @@ const (
bcp47Region
)
-func (r regionID) typ() byte {
+func (r Region) typ() byte {
return regionTypes[r]
}
// String returns the BCP 47 representation for the region.
// It returns "ZZ" for an unspecified region.
-func (r regionID) String() string {
+func (r Region) String() string {
if r < isoRegionOffset {
if r == 0 {
return "ZZ"
@@ -284,7 +300,7 @@ func (r regionID) String() string {
// ISO3 returns the 3-letter ISO code of r.
// Note that not all regions have a 3-letter ISO code.
// In such cases this method returns "ZZZ".
-func (r regionID) ISO3() string {
+func (r Region) ISO3() string {
if r < isoRegionOffset {
return "ZZZ"
}
@@ -301,29 +317,29 @@ func (r regionID) ISO3() string {
// M49 returns the UN M.49 encoding of r, or 0 if this encoding
// is not defined for r.
-func (r regionID) M49() int {
+func (r Region) M49() int {
return int(m49[r])
}
// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
// may include private-use tags that are assigned by CLDR and used in this
// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
-func (r regionID) IsPrivateUse() bool {
+func (r Region) IsPrivateUse() bool {
return r.typ()&iso3166UserAssigned != 0
}
-type scriptID uint8
+type Script uint8
// getScriptID returns the script id for string s. It assumes that s
// is of the format [A-Z][a-z]{3}.
-func getScriptID(idx tag.Index, s []byte) (scriptID, error) {
+func getScriptID(idx tag.Index, s []byte) (Script, error) {
i, err := findIndex(idx, s, "Zzzz")
- return scriptID(i), err
+ return Script(i), err
}
// String returns the script code in title case.
// It returns "Zzzz" for an unspecified script.
-func (s scriptID) String() string {
+func (s Script) String() string {
if s == 0 {
return "Zzzz"
}
@@ -331,7 +347,7 @@ func (s scriptID) String() string {
}
// IsPrivateUse reports whether this script code is reserved for private use.
-func (s scriptID) IsPrivateUse() bool {
+func (s Script) IsPrivateUse() bool {
return _Qaaa <= s && s <= _Qabx
}
@@ -389,7 +405,7 @@ func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
if v < 0 {
return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
}
- t.lang = langID(v)
+ t.LangID = Language(v)
return t, true
}
return t, false
diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go
new file mode 100644
index 0000000..75a2dbc
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/match.go
@@ -0,0 +1,226 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "errors"
+
+type scriptRegionFlags uint8
+
+const (
+ isList = 1 << iota
+ scriptInFrom
+ regionInFrom
+)
+
+func (t *Tag) setUndefinedLang(id Language) {
+ if t.LangID == 0 {
+ t.LangID = id
+ }
+}
+
+func (t *Tag) setUndefinedScript(id Script) {
+ if t.ScriptID == 0 {
+ t.ScriptID = id
+ }
+}
+
+func (t *Tag) setUndefinedRegion(id Region) {
+ if t.RegionID == 0 || t.RegionID.Contains(id) {
+ t.RegionID = id
+ }
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// addLikelySubtags sets subtags to their most likely value, given the locale.
+// In most cases this means setting fields for unknown values, but in some
+// cases it may alter a value. It returns an ErrMissingLikelyTagsData error
+// if the given locale cannot be expanded.
+func (t Tag) addLikelySubtags() (Tag, error) {
+ id, err := addTags(t)
+ if err != nil {
+ return t, err
+ } else if id.equalTags(t) {
+ return t, nil
+ }
+ id.RemakeString()
+ return id, nil
+}
+
+// specializeRegion attempts to specialize a group region.
+func specializeRegion(t *Tag) bool {
+ if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+ x := likelyRegionGroup[i]
+ if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID {
+ t.RegionID = Region(x.region)
+ }
+ return true
+ }
+ return false
+}
+
+// Maximize returns a new tag with missing tags filled in.
+func (t Tag) Maximize() (Tag, error) {
+ return addTags(t)
+}
+
+func addTags(t Tag) (Tag, error) {
+ // We leave private use identifiers alone.
+ if t.IsPrivateUse() {
+ return t, nil
+ }
+ if t.ScriptID != 0 && t.RegionID != 0 {
+ if t.LangID != 0 {
+ // already fully specified
+ specializeRegion(&t)
+ return t, nil
+ }
+ // Search matches for und-script-region. Note that for these cases
+ // region will never be a group so there is no need to check for this.
+ list := likelyRegion[t.RegionID : t.RegionID+1]
+ if x := list[0]; x.flags&isList != 0 {
+ list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
+ }
+ for _, x := range list {
+ // Deviating from the spec. See match_test.go for details.
+ if Script(x.script) == t.ScriptID {
+ t.setUndefinedLang(Language(x.lang))
+ return t, nil
+ }
+ }
+ }
+ if t.LangID != 0 {
+ // Search matches for lang-script and lang-region, where lang != und.
+ if t.LangID < langNoIndexOffset {
+ x := likelyLang[t.LangID]
+ if x.flags&isList != 0 {
+ list := likelyLangList[x.region : x.region+uint16(x.script)]
+ if t.ScriptID != 0 {
+ for _, x := range list {
+ if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 {
+ t.setUndefinedRegion(Region(x.region))
+ return t, nil
+ }
+ }
+ } else if t.RegionID != 0 {
+ count := 0
+ goodScript := true
+ tt := t
+ for _, x := range list {
+ // We visit all entries for which the script was not
+ // defined, including the ones where the region was not
+ // defined. This allows for proper disambiguation within
+ // regions.
+ if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) {
+ tt.RegionID = Region(x.region)
+ tt.setUndefinedScript(Script(x.script))
+ goodScript = goodScript && tt.ScriptID == Script(x.script)
+ count++
+ }
+ }
+ if count == 1 {
+ return tt, nil
+ }
+ // Even if we fail to find a unique Region, we might have
+ // an unambiguous script.
+ if goodScript {
+ t.ScriptID = tt.ScriptID
+ }
+ }
+ }
+ }
+ } else {
+ // Search matches for und-script.
+ if t.ScriptID != 0 {
+ x := likelyScript[t.ScriptID]
+ if x.region != 0 {
+ t.setUndefinedRegion(Region(x.region))
+ t.setUndefinedLang(Language(x.lang))
+ return t, nil
+ }
+ }
+ // Search matches for und-region. If und-script-region exists, it would
+ // have been found earlier.
+ if t.RegionID != 0 {
+ if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+ x := likelyRegionGroup[i]
+ if x.region != 0 {
+ t.setUndefinedLang(Language(x.lang))
+ t.setUndefinedScript(Script(x.script))
+ t.RegionID = Region(x.region)
+ }
+ } else {
+ x := likelyRegion[t.RegionID]
+ if x.flags&isList != 0 {
+ x = likelyRegionList[x.lang]
+ }
+ if x.script != 0 && x.flags != scriptInFrom {
+ t.setUndefinedLang(Language(x.lang))
+ t.setUndefinedScript(Script(x.script))
+ return t, nil
+ }
+ }
+ }
+ }
+
+ // Search matches for lang.
+ if t.LangID < langNoIndexOffset {
+ x := likelyLang[t.LangID]
+ if x.flags&isList != 0 {
+ x = likelyLangList[x.region]
+ }
+ if x.region != 0 {
+ t.setUndefinedScript(Script(x.script))
+ t.setUndefinedRegion(Region(x.region))
+ }
+ specializeRegion(&t)
+ if t.LangID == 0 {
+ t.LangID = _en // default language
+ }
+ return t, nil
+ }
+ return t, ErrMissingLikelyTagsData
+}
+
+func (t *Tag) setTagsFrom(id Tag) {
+ t.LangID = id.LangID
+ t.ScriptID = id.ScriptID
+ t.RegionID = id.RegionID
+}
+
+// minimize removes the region or script subtags from t such that
+// t.addLikelySubtags() == t.minimize().addLikelySubtags().
+func (t Tag) minimize() (Tag, error) {
+ t, err := minimizeTags(t)
+ if err != nil {
+ return t, err
+ }
+ t.RemakeString()
+ return t, nil
+}
+
+// minimizeTags mimics the behavior of the ICU 51 C implementation.
+func minimizeTags(t Tag) (Tag, error) {
+ if t.equalTags(Und) {
+ return t, nil
+ }
+ max, err := addTags(t)
+ if err != nil {
+ return t, err
+ }
+ for _, id := range [...]Tag{
+ {LangID: t.LangID},
+ {LangID: t.LangID, RegionID: t.RegionID},
+ {LangID: t.LangID, ScriptID: t.ScriptID},
+ } {
+ if x, err := addTags(id); err == nil && max.equalTags(x) {
+ t.setTagsFrom(id)
+ break
+ }
+ }
+ return t, nil
+}
diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go
new file mode 100644
index 0000000..2be83e1
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/parse.go
@@ -0,0 +1,594 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "bytes"
+ "errors"
+ "fmt"
+ "sort"
+
+ "golang.org/x/text/internal/tag"
+)
+
+// isAlpha returns true if the byte is not a digit.
+// b must be an ASCII letter or digit.
+func isAlpha(b byte) bool {
+ return b > '9'
+}
+
+// isAlphaNum returns true if the string contains only ASCII letters or digits.
+func isAlphaNum(s []byte) bool {
+ for _, c := range s {
+ if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
+ return false
+ }
+ }
+ return true
+}
+
+// ErrSyntax is returned by any of the parsing functions when the
+// input is not well-formed, according to BCP 47.
+// TODO: return the position at which the syntax error occurred?
+var ErrSyntax = errors.New("language: tag is not well-formed")
+
+// ErrDuplicateKey is returned when a tag contains the same key twice with
+// different values in the -u section.
+var ErrDuplicateKey = errors.New("language: different values for same key in -u extension")
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError struct {
+ v [8]byte
+}
+
+// NewValueError creates a new ValueError.
+func NewValueError(tag []byte) ValueError {
+ var e ValueError
+ copy(e.v[:], tag)
+ return e
+}
+
+func (e ValueError) tag() []byte {
+ n := bytes.IndexByte(e.v[:], 0)
+ if n == -1 {
+ n = 8
+ }
+ return e.v[:n]
+}
+
+// Error implements the error interface.
+func (e ValueError) Error() string {
+ return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
+}
+
+// Subtag returns the subtag for which the error occurred.
+func (e ValueError) Subtag() string {
+ return string(e.tag())
+}
+
+// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
+type scanner struct {
+ b []byte
+ bytes [max99thPercentileSize]byte
+ token []byte
+ start int // start position of the current token
+ end int // end position of the current token
+ next int // next point for scan
+ err error
+ done bool
+}
+
+func makeScannerString(s string) scanner {
+ scan := scanner{}
+ if len(s) <= len(scan.bytes) {
+ scan.b = scan.bytes[:copy(scan.bytes[:], s)]
+ } else {
+ scan.b = []byte(s)
+ }
+ scan.init()
+ return scan
+}
+
+// makeScanner returns a scanner using b as the input buffer.
+// b is not copied and may be modified by the scanner routines.
+func makeScanner(b []byte) scanner {
+ scan := scanner{b: b}
+ scan.init()
+ return scan
+}
+
+func (s *scanner) init() {
+ for i, c := range s.b {
+ if c == '_' {
+ s.b[i] = '-'
+ }
+ }
+ s.scan()
+}
+
+// restToLower converts the string between start and end to lower case.
+func (s *scanner) toLower(start, end int) {
+ for i := start; i < end; i++ {
+ c := s.b[i]
+ if 'A' <= c && c <= 'Z' {
+ s.b[i] += 'a' - 'A'
+ }
+ }
+}
+
+func (s *scanner) setError(e error) {
+ if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) {
+ s.err = e
+ }
+}
+
+// resizeRange shrinks or grows the array at position oldStart such that
+// a new string of size newSize can fit between oldStart and oldEnd.
+// Sets the scan point to after the resized range.
+func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
+ s.start = oldStart
+ if end := oldStart + newSize; end != oldEnd {
+ diff := end - oldEnd
+ if end < cap(s.b) {
+ b := make([]byte, len(s.b)+diff)
+ copy(b, s.b[:oldStart])
+ copy(b[end:], s.b[oldEnd:])
+ s.b = b
+ } else {
+ s.b = append(s.b[end:], s.b[oldEnd:]...)
+ }
+ s.next = end + (s.next - s.end)
+ s.end = end
+ }
+}
+
+// replace replaces the current token with repl.
+func (s *scanner) replace(repl string) {
+ s.resizeRange(s.start, s.end, len(repl))
+ copy(s.b[s.start:], repl)
+}
+
+// gobble removes the current token from the input.
+// Caller must call scan after calling gobble.
+func (s *scanner) gobble(e error) {
+ s.setError(e)
+ if s.start == 0 {
+ s.b = s.b[:+copy(s.b, s.b[s.next:])]
+ s.end = 0
+ } else {
+ s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
+ s.end = s.start - 1
+ }
+ s.next = s.start
+}
+
+// deleteRange removes the given range from s.b before the current token.
+func (s *scanner) deleteRange(start, end int) {
+ s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
+ diff := end - start
+ s.next -= diff
+ s.start -= diff
+ s.end -= diff
+}
+
+// scan parses the next token of a BCP 47 string. Tokens that are larger
+// than 8 characters or include non-alphanumeric characters result in an error
+// and are gobbled and removed from the output.
+// It returns the end position of the last token consumed.
+func (s *scanner) scan() (end int) {
+ end = s.end
+ s.token = nil
+ for s.start = s.next; s.next < len(s.b); {
+ i := bytes.IndexByte(s.b[s.next:], '-')
+ if i == -1 {
+ s.end = len(s.b)
+ s.next = len(s.b)
+ i = s.end - s.start
+ } else {
+ s.end = s.next + i
+ s.next = s.end + 1
+ }
+ token := s.b[s.start:s.end]
+ if i < 1 || i > 8 || !isAlphaNum(token) {
+ s.gobble(ErrSyntax)
+ continue
+ }
+ s.token = token
+ return end
+ }
+ if n := len(s.b); n > 0 && s.b[n-1] == '-' {
+ s.setError(ErrSyntax)
+ s.b = s.b[:len(s.b)-1]
+ }
+ s.done = true
+ return end
+}
+
+// acceptMinSize parses multiple tokens of the given size or greater.
+// It returns the end position of the last token consumed.
+func (s *scanner) acceptMinSize(min int) (end int) {
+ end = s.end
+ s.scan()
+ for ; len(s.token) >= min; s.scan() {
+ end = s.end
+ }
+ return end
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+func Parse(s string) (t Tag, err error) {
+ // TODO: consider supporting old-style locale key-value pairs.
+ if s == "" {
+ return Und, ErrSyntax
+ }
+ if len(s) <= maxAltTaglen {
+ b := [maxAltTaglen]byte{}
+ for i, c := range s {
+ // Generating invalid UTF-8 is okay as it won't match.
+ if 'A' <= c && c <= 'Z' {
+ c += 'a' - 'A'
+ } else if c == '_' {
+ c = '-'
+ }
+ b[i] = byte(c)
+ }
+ if t, ok := grandfathered(b); ok {
+ return t, nil
+ }
+ }
+ scan := makeScannerString(s)
+ return parse(&scan, s)
+}
+
+func parse(scan *scanner, s string) (t Tag, err error) {
+ t = Und
+ var end int
+ if n := len(scan.token); n <= 1 {
+ scan.toLower(0, len(scan.b))
+ if n == 0 || scan.token[0] != 'x' {
+ return t, ErrSyntax
+ }
+ end = parseExtensions(scan)
+ } else if n >= 4 {
+ return Und, ErrSyntax
+ } else { // the usual case
+ t, end = parseTag(scan)
+ if n := len(scan.token); n == 1 {
+ t.pExt = uint16(end)
+ end = parseExtensions(scan)
+ } else if end < len(scan.b) {
+ scan.setError(ErrSyntax)
+ scan.b = scan.b[:end]
+ }
+ }
+ if int(t.pVariant) < len(scan.b) {
+ if end < len(s) {
+ s = s[:end]
+ }
+ if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
+ t.str = s
+ } else {
+ t.str = string(scan.b)
+ }
+ } else {
+ t.pVariant, t.pExt = 0, 0
+ }
+ return t, scan.err
+}
+
+// parseTag parses language, script, region and variants.
+// It returns a Tag and the end position in the input that was parsed.
+func parseTag(scan *scanner) (t Tag, end int) {
+ var e error
+ // TODO: set an error if an unknown lang, script or region is encountered.
+ t.LangID, e = getLangID(scan.token)
+ scan.setError(e)
+ scan.replace(t.LangID.String())
+ langStart := scan.start
+ end = scan.scan()
+ for len(scan.token) == 3 && isAlpha(scan.token[0]) {
+ // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
+ // to a tag of the form <extlang>.
+ lang, e := getLangID(scan.token)
+ if lang != 0 {
+ t.LangID = lang
+ copy(scan.b[langStart:], lang.String())
+ scan.b[langStart+3] = '-'
+ scan.start = langStart + 4
+ }
+ scan.gobble(e)
+ end = scan.scan()
+ }
+ if len(scan.token) == 4 && isAlpha(scan.token[0]) {
+ t.ScriptID, e = getScriptID(script, scan.token)
+ if t.ScriptID == 0 {
+ scan.gobble(e)
+ }
+ end = scan.scan()
+ }
+ if n := len(scan.token); n >= 2 && n <= 3 {
+ t.RegionID, e = getRegionID(scan.token)
+ if t.RegionID == 0 {
+ scan.gobble(e)
+ } else {
+ scan.replace(t.RegionID.String())
+ }
+ end = scan.scan()
+ }
+ scan.toLower(scan.start, len(scan.b))
+ t.pVariant = byte(end)
+ end = parseVariants(scan, end, t)
+ t.pExt = uint16(end)
+ return t, end
+}
+
+var separator = []byte{'-'}
+
+// parseVariants scans tokens as long as each token is a valid variant string.
+// Duplicate variants are removed.
+func parseVariants(scan *scanner, end int, t Tag) int {
+ start := scan.start
+ varIDBuf := [4]uint8{}
+ variantBuf := [4][]byte{}
+ varID := varIDBuf[:0]
+ variant := variantBuf[:0]
+ last := -1
+ needSort := false
+ for ; len(scan.token) >= 4; scan.scan() {
+ // TODO: measure the impact of needing this conversion and redesign
+ // the data structure if there is an issue.
+ v, ok := variantIndex[string(scan.token)]
+ if !ok {
+ // unknown variant
+ // TODO: allow user-defined variants?
+ scan.gobble(NewValueError(scan.token))
+ continue
+ }
+ varID = append(varID, v)
+ variant = append(variant, scan.token)
+ if !needSort {
+ if last < int(v) {
+ last = int(v)
+ } else {
+ needSort = true
+ // There is no legal combinations of more than 7 variants
+ // (and this is by no means a useful sequence).
+ const maxVariants = 8
+ if len(varID) > maxVariants {
+ break
+ }
+ }
+ }
+ end = scan.end
+ }
+ if needSort {
+ sort.Sort(variantsSort{varID, variant})
+ k, l := 0, -1
+ for i, v := range varID {
+ w := int(v)
+ if l == w {
+ // Remove duplicates.
+ continue
+ }
+ varID[k] = varID[i]
+ variant[k] = variant[i]
+ k++
+ l = w
+ }
+ if str := bytes.Join(variant[:k], separator); len(str) == 0 {
+ end = start - 1
+ } else {
+ scan.resizeRange(start, end, len(str))
+ copy(scan.b[scan.start:], str)
+ end = scan.end
+ }
+ }
+ return end
+}
+
+type variantsSort struct {
+ i []uint8
+ v [][]byte
+}
+
+func (s variantsSort) Len() int {
+ return len(s.i)
+}
+
+func (s variantsSort) Swap(i, j int) {
+ s.i[i], s.i[j] = s.i[j], s.i[i]
+ s.v[i], s.v[j] = s.v[j], s.v[i]
+}
+
+func (s variantsSort) Less(i, j int) bool {
+ return s.i[i] < s.i[j]
+}
+
+type bytesSort struct {
+ b [][]byte
+ n int // first n bytes to compare
+}
+
+func (b bytesSort) Len() int {
+ return len(b.b)
+}
+
+func (b bytesSort) Swap(i, j int) {
+ b.b[i], b.b[j] = b.b[j], b.b[i]
+}
+
+func (b bytesSort) Less(i, j int) bool {
+ for k := 0; k < b.n; k++ {
+ if b.b[i][k] == b.b[j][k] {
+ continue
+ }
+ return b.b[i][k] < b.b[j][k]
+ }
+ return false
+}
+
+// parseExtensions parses and normalizes the extensions in the buffer.
+// It returns the last position of scan.b that is part of any extension.
+// It also trims scan.b to remove excess parts accordingly.
+func parseExtensions(scan *scanner) int {
+ start := scan.start
+ exts := [][]byte{}
+ private := []byte{}
+ end := scan.end
+ for len(scan.token) == 1 {
+ extStart := scan.start
+ ext := scan.token[0]
+ end = parseExtension(scan)
+ extension := scan.b[extStart:end]
+ if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
+ scan.setError(ErrSyntax)
+ end = extStart
+ continue
+ } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
+ scan.b = scan.b[:end]
+ return end
+ } else if ext == 'x' {
+ private = extension
+ break
+ }
+ exts = append(exts, extension)
+ }
+ sort.Sort(bytesSort{exts, 1})
+ if len(private) > 0 {
+ exts = append(exts, private)
+ }
+ scan.b = scan.b[:start]
+ if len(exts) > 0 {
+ scan.b = append(scan.b, bytes.Join(exts, separator)...)
+ } else if start > 0 {
+ // Strip trailing '-'.
+ scan.b = scan.b[:start-1]
+ }
+ return end
+}
+
+// parseExtension parses a single extension and returns the position of
+// the extension end.
+func parseExtension(scan *scanner) int {
+ start, end := scan.start, scan.end
+ switch scan.token[0] {
+ case 'u':
+ attrStart := end
+ scan.scan()
+ for last := []byte{}; len(scan.token) > 2; scan.scan() {
+ if bytes.Compare(scan.token, last) != -1 {
+ // Attributes are unsorted. Start over from scratch.
+ p := attrStart + 1
+ scan.next = p
+ attrs := [][]byte{}
+ for scan.scan(); len(scan.token) > 2; scan.scan() {
+ attrs = append(attrs, scan.token)
+ end = scan.end
+ }
+ sort.Sort(bytesSort{attrs, 3})
+ copy(scan.b[p:], bytes.Join(attrs, separator))
+ break
+ }
+ last = scan.token
+ end = scan.end
+ }
+ var last, key []byte
+ for attrEnd := end; len(scan.token) == 2; last = key {
+ key = scan.token
+ keyEnd := scan.end
+ end = scan.acceptMinSize(3)
+ // TODO: check key value validity
+ if keyEnd == end || bytes.Compare(key, last) != 1 {
+ // We have an invalid key or the keys are not sorted.
+ // Start scanning keys from scratch and reorder.
+ p := attrEnd + 1
+ scan.next = p
+ keys := [][]byte{}
+ for scan.scan(); len(scan.token) == 2; {
+ keyStart, keyEnd := scan.start, scan.end
+ end = scan.acceptMinSize(3)
+ if keyEnd != end {
+ keys = append(keys, scan.b[keyStart:end])
+ } else {
+ scan.setError(ErrSyntax)
+ end = keyStart
+ }
+ }
+ sort.Stable(bytesSort{keys, 2})
+ if n := len(keys); n > 0 {
+ k := 0
+ for i := 1; i < n; i++ {
+ if !bytes.Equal(keys[k][:2], keys[i][:2]) {
+ k++
+ keys[k] = keys[i]
+ } else if !bytes.Equal(keys[k], keys[i]) {
+ scan.setError(ErrDuplicateKey)
+ }
+ }
+ keys = keys[:k+1]
+ }
+ reordered := bytes.Join(keys, separator)
+ if e := p + len(reordered); e < end {
+ scan.deleteRange(e, end)
+ end = e
+ }
+ copy(scan.b[p:], reordered)
+ break
+ }
+ }
+ case 't':
+ scan.scan()
+ if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
+ _, end = parseTag(scan)
+ scan.toLower(start, end)
+ }
+ for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
+ end = scan.acceptMinSize(3)
+ }
+ case 'x':
+ end = scan.acceptMinSize(1)
+ default:
+ end = scan.acceptMinSize(2)
+ }
+ return end
+}
+
+// getExtension returns the name, body and end position of the extension.
+func getExtension(s string, p int) (end int, ext string) {
+ if s[p] == '-' {
+ p++
+ }
+ if s[p] == 'x' {
+ return len(s), s[p:]
+ }
+ end = nextExtension(s, p)
+ return end, s[p:end]
+}
+
+// nextExtension finds the next extension within the string, searching
+// for the -<char>- pattern from position p.
+// In the fast majority of cases, language tags will have at most
+// one extension and extensions tend to be small.
+func nextExtension(s string, p int) int {
+ for n := len(s) - 3; p < n; {
+ if s[p] == '-' {
+ if s[p+2] == '-' {
+ return p
+ }
+ p += 3
+ } else {
+ p++
+ }
+ }
+ return len(s)
+}
diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go
new file mode 100644
index 0000000..239e2d2
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tables.go
@@ -0,0 +1,3431 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+import "golang.org/x/text/internal/tag"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+const NumLanguages = 8665
+
+const NumScripts = 242
+
+const NumRegions = 357
+
+type FromTo struct {
+ From uint16
+ To uint16
+}
+
+const nonCanonicalUnd = 1201
+const (
+ _af = 22
+ _am = 39
+ _ar = 58
+ _az = 88
+ _bg = 126
+ _bn = 165
+ _ca = 215
+ _cs = 250
+ _da = 257
+ _de = 269
+ _el = 310
+ _en = 313
+ _es = 318
+ _et = 320
+ _fa = 328
+ _fi = 337
+ _fil = 339
+ _fr = 350
+ _gu = 420
+ _he = 444
+ _hi = 446
+ _hr = 465
+ _hu = 469
+ _hy = 471
+ _id = 481
+ _is = 504
+ _it = 505
+ _ja = 512
+ _ka = 528
+ _kk = 578
+ _km = 586
+ _kn = 593
+ _ko = 596
+ _ky = 650
+ _lo = 696
+ _lt = 704
+ _lv = 711
+ _mk = 767
+ _ml = 772
+ _mn = 779
+ _mo = 784
+ _mr = 795
+ _ms = 799
+ _mul = 806
+ _my = 817
+ _nb = 839
+ _ne = 849
+ _nl = 871
+ _no = 879
+ _pa = 925
+ _pl = 947
+ _pt = 960
+ _ro = 988
+ _ru = 994
+ _sh = 1031
+ _si = 1036
+ _sk = 1042
+ _sl = 1046
+ _sq = 1073
+ _sr = 1074
+ _sv = 1092
+ _sw = 1093
+ _ta = 1104
+ _te = 1121
+ _th = 1131
+ _tl = 1146
+ _tn = 1152
+ _tr = 1162
+ _uk = 1198
+ _ur = 1204
+ _uz = 1212
+ _vi = 1219
+ _zh = 1321
+ _zu = 1327
+ _jbo = 515
+ _ami = 1650
+ _bnn = 2357
+ _hak = 438
+ _tlh = 14467
+ _lb = 661
+ _nv = 899
+ _pwn = 12055
+ _tao = 14188
+ _tay = 14198
+ _tsu = 14662
+ _nn = 874
+ _sfb = 13629
+ _vgt = 15701
+ _sgg = 13660
+ _cmn = 3007
+ _nan = 835
+ _hsn = 467
+)
+
+const langPrivateStart = 0x2f72
+
+const langPrivateEnd = 0x3179
+
+// lang holds an alphabetically sorted list of ISO-639 language identifiers.
+// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+// For 2-byte language identifiers, the two successive bytes have the following meaning:
+// - if the first letter of the 2- and 3-letter ISO codes are the same:
+// the second and third letter of the 3-letter ISO code.
+// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+// For 3-byte language identifiers the 4th byte is 0.
+const lang tag.Index = "" + // Size: 5324 bytes
+ "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
+ "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
+ "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
+ "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
+ "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
+ "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
+ "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
+ "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
+ "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
+ "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
+ "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
+ "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
+ "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
+ "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
+ "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
+ "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
+ "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
+ "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
+ "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
+ "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
+ "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
+ "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
+ "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
+ "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
+ "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
+ "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
+ "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
+ "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
+ "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
+ "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
+ "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
+ "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
+ "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
+ "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
+ "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
+ "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
+ "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
+ "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
+ "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
+ "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
+ "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
+ "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
+ "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
+ "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
+ "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
+ "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
+ "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
+ "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
+ "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
+ "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
+ "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
+ "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
+ "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
+ "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
+ "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
+ "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
+ "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
+ "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
+ "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
+ "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
+ "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
+ "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
+ "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
+ "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
+ "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
+ "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
+ "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
+ "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
+ "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
+ "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
+ "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
+ "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
+ "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
+ "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
+ "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
+ "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
+ "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
+ "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
+ "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
+ "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
+ "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
+ "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
+ "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
+ "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
+ "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
+ "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
+ "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
+ "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
+ "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
+ "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
+ "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
+ "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
+ "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
+ "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
+ "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
+ "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
+ "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
+ "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
+ "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
+ "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
+ "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
+ "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
+ "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
+ "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
+ "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
+ "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
+ "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
+ "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
+ "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
+ "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
+ "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
+ "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
+ "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
+ "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
+ "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
+ "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
+ "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
+ "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
+ "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
+ "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
+ "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
+ "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
+ "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
+ "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
+
+const langNoIndexOffset = 1330
+
+// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+// in lookup tables. The language ids for these language codes are derived directly
+// from the letters and are not consecutive.
+// Size: 2197 bytes, 2197 elements
+var langNoIndex = [2197]uint8{
+ // Entry 0 - 3F
+ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
+ 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
+ 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
+ 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
+ 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
+ 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
+ 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
+ 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
+ // Entry 40 - 7F
+ 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
+ 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
+ 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
+ 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
+ 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
+ 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
+ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
+ 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
+ // Entry 80 - BF
+ 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
+ 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
+ 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
+ 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
+ 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
+ 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
+ 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
+ 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
+ // Entry C0 - FF
+ 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
+ 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
+ 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
+ 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
+ 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
+ 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
+ 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
+ // Entry 100 - 13F
+ 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
+ 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
+ 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
+ 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
+ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
+ 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
+ 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
+ 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
+ // Entry 140 - 17F
+ 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
+ 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
+ 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
+ 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
+ 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
+ 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
+ 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
+ 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
+ // Entry 180 - 1BF
+ 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
+ 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
+ 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
+ // Entry 1C0 - 1FF
+ 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
+ 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
+ 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
+ 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
+ // Entry 200 - 23F
+ 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
+ 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
+ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
+ 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
+ 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
+ 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
+ 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
+ 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
+ // Entry 240 - 27F
+ 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
+ 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
+ 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
+ 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
+ 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
+ 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
+ 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
+ // Entry 280 - 2BF
+ 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
+ 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
+ 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
+ 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+ 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
+ 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
+ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
+ 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
+ // Entry 2C0 - 2FF
+ 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
+ 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
+ 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
+ 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
+ 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
+ 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
+ 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
+ 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
+ // Entry 300 - 33F
+ 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
+ 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
+ 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
+ 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
+ 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
+ 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
+ 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
+ // Entry 340 - 37F
+ 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
+ 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
+ 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
+ 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
+ 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
+ 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
+ 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
+ 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
+ // Entry 380 - 3BF
+ 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
+ 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
+ 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
+ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
+ 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
+ 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
+ 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
+ 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
+ // Entry 3C0 - 3FF
+ 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
+ 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
+ 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
+ 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
+ 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
+ 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
+ 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
+ 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
+ // Entry 400 - 43F
+ 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
+ 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
+ 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
+ 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
+ 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
+ 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
+ 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
+ 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
+ // Entry 440 - 47F
+ 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
+ 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
+ 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
+ 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
+ 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
+ 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
+ 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
+ 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
+ // Entry 480 - 4BF
+ 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
+ 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
+ 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
+ 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
+ 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
+ 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
+ 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
+ // Entry 4C0 - 4FF
+ 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
+ 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
+ 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
+ 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
+ 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
+ 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
+ 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
+ // Entry 500 - 53F
+ 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
+ 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
+ 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
+ 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
+ 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
+ 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
+ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
+ 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
+ // Entry 540 - 57F
+ 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ // Entry 580 - 5BF
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
+ 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
+ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
+ 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
+ 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
+ 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
+ 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
+ // Entry 5C0 - 5FF
+ 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
+ 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
+ 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
+ 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
+ 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
+ 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
+ 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
+ 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
+ // Entry 600 - 63F
+ 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
+ 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
+ 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
+ 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
+ 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
+ 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
+ 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
+ 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
+ // Entry 640 - 67F
+ 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
+ 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
+ 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
+ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
+ 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
+ 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
+ 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
+ 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
+ // Entry 680 - 6BF
+ 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
+ 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
+ 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
+ 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
+ 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
+ 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
+ 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
+ 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
+ // Entry 6C0 - 6FF
+ 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
+ 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
+ 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
+ 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
+ 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
+ 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
+ // Entry 700 - 73F
+ 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
+ 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
+ 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
+ 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
+ 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
+ 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 740 - 77F
+ 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
+ 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
+ 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
+ 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
+ 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
+ 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
+ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
+ // Entry 780 - 7BF
+ 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
+ 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
+ 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
+ 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
+ 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
+ 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
+ 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
+ 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
+ // Entry 7C0 - 7FF
+ 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
+ 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
+ 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
+ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
+ 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
+ 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
+ 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
+ 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
+ // Entry 800 - 83F
+ 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
+ 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
+ 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
+ 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
+ 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
+ 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
+ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
+ 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
+ // Entry 840 - 87F
+ 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
+ 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
+ 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
+ 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
+ 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
+ 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
+ 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
+ // Entry 880 - 8BF
+ 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
+ 0x0a, 0x00, 0x80, 0x00, 0x00,
+}
+
+// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+// to 2-letter language codes that cannot be derived using the method described above.
+// Each 3-letter code is followed by its 1-byte langID.
+const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
+
+// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
+// Size: 12 bytes, 6 elements
+var altLangIndex = [6]uint16{
+ 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
+}
+
+// AliasMap maps langIDs to their suggested replacements.
+// Size: 656 bytes, 164 elements
+var AliasMap = [164]FromTo{
+ 0: {From: 0x82, To: 0x88},
+ 1: {From: 0x187, To: 0x1ae},
+ 2: {From: 0x1f3, To: 0x1e1},
+ 3: {From: 0x1fb, To: 0x1bc},
+ 4: {From: 0x208, To: 0x512},
+ 5: {From: 0x20f, To: 0x20e},
+ 6: {From: 0x310, To: 0x3dc},
+ 7: {From: 0x347, To: 0x36f},
+ 8: {From: 0x407, To: 0x432},
+ 9: {From: 0x47a, To: 0x153},
+ 10: {From: 0x490, To: 0x451},
+ 11: {From: 0x4a2, To: 0x21},
+ 12: {From: 0x53e, To: 0x544},
+ 13: {From: 0x58f, To: 0x12d},
+ 14: {From: 0x630, To: 0x1eb1},
+ 15: {From: 0x651, To: 0x431},
+ 16: {From: 0x662, To: 0x431},
+ 17: {From: 0x6ed, To: 0x3a},
+ 18: {From: 0x6f8, To: 0x1d7},
+ 19: {From: 0x73e, To: 0x21a1},
+ 20: {From: 0x7b3, To: 0x56},
+ 21: {From: 0x7b9, To: 0x299b},
+ 22: {From: 0x7c5, To: 0x58},
+ 23: {From: 0x7e6, To: 0x145},
+ 24: {From: 0x80c, To: 0x5a},
+ 25: {From: 0x815, To: 0x8d},
+ 26: {From: 0x87e, To: 0x810},
+ 27: {From: 0x8c3, To: 0xee3},
+ 28: {From: 0x9ef, To: 0x331},
+ 29: {From: 0xa36, To: 0x2c5},
+ 30: {From: 0xa3d, To: 0xbf},
+ 31: {From: 0xabe, To: 0x3322},
+ 32: {From: 0xb38, To: 0x529},
+ 33: {From: 0xb75, To: 0x265a},
+ 34: {From: 0xb7e, To: 0xbc3},
+ 35: {From: 0xb9b, To: 0x44e},
+ 36: {From: 0xbbc, To: 0x4229},
+ 37: {From: 0xbbf, To: 0x529},
+ 38: {From: 0xbfe, To: 0x2da7},
+ 39: {From: 0xc2e, To: 0x3181},
+ 40: {From: 0xcb9, To: 0xf3},
+ 41: {From: 0xd08, To: 0xfa},
+ 42: {From: 0xdc8, To: 0x11a},
+ 43: {From: 0xdd7, To: 0x32d},
+ 44: {From: 0xdf8, To: 0xdfb},
+ 45: {From: 0xdfe, To: 0x531},
+ 46: {From: 0xedf, To: 0x205a},
+ 47: {From: 0xeee, To: 0x2e9a},
+ 48: {From: 0xf39, To: 0x367},
+ 49: {From: 0x10d0, To: 0x140},
+ 50: {From: 0x1104, To: 0x2d0},
+ 51: {From: 0x11a0, To: 0x1ec},
+ 52: {From: 0x1279, To: 0x21},
+ 53: {From: 0x1424, To: 0x15e},
+ 54: {From: 0x1470, To: 0x14e},
+ 55: {From: 0x151f, To: 0xd9b},
+ 56: {From: 0x1523, To: 0x390},
+ 57: {From: 0x1532, To: 0x19f},
+ 58: {From: 0x1580, To: 0x210},
+ 59: {From: 0x1583, To: 0x10d},
+ 60: {From: 0x15a3, To: 0x3caf},
+ 61: {From: 0x166a, To: 0x19b},
+ 62: {From: 0x16c8, To: 0x136},
+ 63: {From: 0x1700, To: 0x29f8},
+ 64: {From: 0x1718, To: 0x194},
+ 65: {From: 0x1727, To: 0xf3f},
+ 66: {From: 0x177a, To: 0x178},
+ 67: {From: 0x1809, To: 0x17b6},
+ 68: {From: 0x1816, To: 0x18f3},
+ 69: {From: 0x188a, To: 0x436},
+ 70: {From: 0x1979, To: 0x1d01},
+ 71: {From: 0x1a74, To: 0x2bb0},
+ 72: {From: 0x1a8a, To: 0x1f8},
+ 73: {From: 0x1b5a, To: 0x1fa},
+ 74: {From: 0x1b86, To: 0x1515},
+ 75: {From: 0x1d64, To: 0x2c9b},
+ 76: {From: 0x2038, To: 0x37b1},
+ 77: {From: 0x203d, To: 0x20dd},
+ 78: {From: 0x205a, To: 0x30b},
+ 79: {From: 0x20e3, To: 0x274},
+ 80: {From: 0x20ee, To: 0x263},
+ 81: {From: 0x20f2, To: 0x22d},
+ 82: {From: 0x20f9, To: 0x256},
+ 83: {From: 0x210f, To: 0x21eb},
+ 84: {From: 0x2135, To: 0x27d},
+ 85: {From: 0x2160, To: 0x913},
+ 86: {From: 0x2199, To: 0x121},
+ 87: {From: 0x21ce, To: 0x1561},
+ 88: {From: 0x21e6, To: 0x504},
+ 89: {From: 0x21f4, To: 0x49f},
+ 90: {From: 0x222d, To: 0x121},
+ 91: {From: 0x2237, To: 0x121},
+ 92: {From: 0x2262, To: 0x92a},
+ 93: {From: 0x2316, To: 0x3226},
+ 94: {From: 0x2382, To: 0x3365},
+ 95: {From: 0x2472, To: 0x2c7},
+ 96: {From: 0x24e4, To: 0x2ff},
+ 97: {From: 0x24f0, To: 0x2fa},
+ 98: {From: 0x24fa, To: 0x31f},
+ 99: {From: 0x2550, To: 0xb5b},
+ 100: {From: 0x25a9, To: 0xe2},
+ 101: {From: 0x263e, To: 0x2d0},
+ 102: {From: 0x26c9, To: 0x26b4},
+ 103: {From: 0x26f9, To: 0x3c8},
+ 104: {From: 0x2727, To: 0x3caf},
+ 105: {From: 0x2765, To: 0x26b4},
+ 106: {From: 0x2789, To: 0x4358},
+ 107: {From: 0x28ef, To: 0x2837},
+ 108: {From: 0x2914, To: 0x351},
+ 109: {From: 0x2986, To: 0x2da7},
+ 110: {From: 0x2b1a, To: 0x38d},
+ 111: {From: 0x2bfc, To: 0x395},
+ 112: {From: 0x2c3f, To: 0x3caf},
+ 113: {From: 0x2cfc, To: 0x3be},
+ 114: {From: 0x2d13, To: 0x597},
+ 115: {From: 0x2d47, To: 0x148},
+ 116: {From: 0x2d48, To: 0x148},
+ 117: {From: 0x2dff, To: 0x2f1},
+ 118: {From: 0x2e08, To: 0x19cc},
+ 119: {From: 0x2e1a, To: 0x2d95},
+ 120: {From: 0x2e21, To: 0x292},
+ 121: {From: 0x2e54, To: 0x7d},
+ 122: {From: 0x2e65, To: 0x2282},
+ 123: {From: 0x2ea0, To: 0x2e9b},
+ 124: {From: 0x2eef, To: 0x2ed7},
+ 125: {From: 0x3193, To: 0x3c4},
+ 126: {From: 0x3366, To: 0x338e},
+ 127: {From: 0x342a, To: 0x3dc},
+ 128: {From: 0x34ee, To: 0x18d0},
+ 129: {From: 0x35c8, To: 0x2c9b},
+ 130: {From: 0x35e6, To: 0x412},
+ 131: {From: 0x3658, To: 0x246},
+ 132: {From: 0x3676, To: 0x3f4},
+ 133: {From: 0x36fd, To: 0x445},
+ 134: {From: 0x37c0, To: 0x121},
+ 135: {From: 0x3816, To: 0x38f2},
+ 136: {From: 0x382b, To: 0x2c9b},
+ 137: {From: 0x382f, To: 0xa9},
+ 138: {From: 0x3832, To: 0x3228},
+ 139: {From: 0x386c, To: 0x39a6},
+ 140: {From: 0x3892, To: 0x3fc0},
+ 141: {From: 0x38a5, To: 0x39d7},
+ 142: {From: 0x38b4, To: 0x1fa4},
+ 143: {From: 0x38b5, To: 0x2e9a},
+ 144: {From: 0x395c, To: 0x47e},
+ 145: {From: 0x3b4e, To: 0xd91},
+ 146: {From: 0x3b78, To: 0x137},
+ 147: {From: 0x3c99, To: 0x4bc},
+ 148: {From: 0x3fbd, To: 0x100},
+ 149: {From: 0x4208, To: 0xa91},
+ 150: {From: 0x42be, To: 0x573},
+ 151: {From: 0x42f9, To: 0x3f60},
+ 152: {From: 0x4378, To: 0x25a},
+ 153: {From: 0x43cb, To: 0x36cb},
+ 154: {From: 0x43cd, To: 0x10f},
+ 155: {From: 0x44af, To: 0x3322},
+ 156: {From: 0x44e3, To: 0x512},
+ 157: {From: 0x45ca, To: 0x2409},
+ 158: {From: 0x45dd, To: 0x26dc},
+ 159: {From: 0x4610, To: 0x48ae},
+ 160: {From: 0x46ae, To: 0x46a0},
+ 161: {From: 0x473e, To: 0x4745},
+ 162: {From: 0x4916, To: 0x31f},
+ 163: {From: 0x49a7, To: 0x523},
+}
+
+// Size: 164 bytes, 164 elements
+var AliasTypes = [164]AliasType{
+ // Entry 0 - 3F
+ 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
+ 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
+ 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
+ 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
+ // Entry 40 - 7F
+ 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
+ 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
+ 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
+ 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
+ // Entry 80 - BF
+ 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
+ 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
+ 0, 1, 1, 1,
+}
+
+const (
+ _Latn = 87
+ _Hani = 54
+ _Hans = 56
+ _Hant = 57
+ _Qaaa = 139
+ _Qaai = 147
+ _Qabx = 188
+ _Zinh = 236
+ _Zyyy = 241
+ _Zzzz = 242
+)
+
+// script is an alphabetically sorted list of ISO 15924 codes. The index
+// of the script in the string, divided by 4, is the internal scriptID.
+const script tag.Index = "" + // Size: 976 bytes
+ "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
+ "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
+ "DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
+ "HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
+ "KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
+ "LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
+ "ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
+ "OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
+ "QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
+ "QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
+ "QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
+ "ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
+ "TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
+ "YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
+
+// suppressScript is an index from langID to the dominant script for that language,
+// if it exists. If a script is given, it should be suppressed from the language tag.
+// Size: 1330 bytes, 1330 elements
+var suppressScript = [1330]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 40 - 7F
+ 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+ // Entry 80 - BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry C0 - FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 100 - 13F
+ 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
+ // Entry 140 - 17F
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 180 - 1BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
+ // Entry 1C0 - 1FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
+ // Entry 200 - 23F
+ 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 240 - 27F
+ 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 280 - 2BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 2C0 - 2FF
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
+ // Entry 300 - 33F
+ 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ // Entry 340 - 37F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 380 - 3BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
+ // Entry 3C0 - 3FF
+ 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 400 - 43F
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ // Entry 440 - 47F
+ 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ // Entry 480 - 4BF
+ 0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 4C0 - 4FF
+ 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 500 - 53F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00,
+}
+
+const (
+ _001 = 1
+ _419 = 31
+ _BR = 65
+ _CA = 73
+ _ES = 110
+ _GB = 123
+ _MD = 188
+ _PT = 238
+ _UK = 306
+ _US = 309
+ _ZZ = 357
+ _XA = 323
+ _XC = 325
+ _XK = 333
+)
+
+// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+// the UN.M49 codes used for groups.)
+const isoRegionOffset = 32
+
+// regionTypes defines the status of a region for various standards.
+// Size: 358 bytes, 358 elements
+var regionTypes = [358]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 40 - 7F
+ 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
+ 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
+ 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 80 - BF
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry C0 - FF
+ 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ // Entry 100 - 13F
+ 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 140 - 17F
+ 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
+ 0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
+}
+
+// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+// Each 2-letter codes is followed by two bytes with the following meaning:
+// - [A-Z}{2}: the first letter of the 2-letter code plus these two
+// letters form the 3-letter ISO code.
+// - 0, n: index into altRegionISO3.
+const regionISO tag.Index = "" + // Size: 1308 bytes
+ "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
+ "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
+ "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
+ "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
+ "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" +
+ "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
+ "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" +
+ "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
+ "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
+ "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
+ "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
+ "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
+ "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
+ "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
+ "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
+ "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
+ "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
+ "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
+ "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
+ "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
+
+// altRegionISO3 holds a list of 3-letter region codes that cannot be
+// mapped to 2-letter codes using the default algorithm. This is a short list.
+const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
+
+// altRegionIDs holds a list of regionIDs the positions of which match those
+// of the 3-letter ISO codes in altRegionISO3.
+// Size: 22 bytes, 11 elements
+var altRegionIDs = [11]uint16{
+ 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
+ 0x0121, 0x015f, 0x00dc,
+}
+
+// Size: 80 bytes, 20 elements
+var regionOldMap = [20]FromTo{
+ 0: {From: 0x44, To: 0xc4},
+ 1: {From: 0x58, To: 0xa7},
+ 2: {From: 0x5f, To: 0x60},
+ 3: {From: 0x66, To: 0x3b},
+ 4: {From: 0x79, To: 0x78},
+ 5: {From: 0x93, To: 0x37},
+ 6: {From: 0xa3, To: 0x133},
+ 7: {From: 0xc1, To: 0x133},
+ 8: {From: 0xd7, To: 0x13f},
+ 9: {From: 0xdc, To: 0x2b},
+ 10: {From: 0xef, To: 0x133},
+ 11: {From: 0xf2, To: 0xe2},
+ 12: {From: 0xfc, To: 0x70},
+ 13: {From: 0x103, To: 0x164},
+ 14: {From: 0x12a, To: 0x126},
+ 15: {From: 0x132, To: 0x7b},
+ 16: {From: 0x13a, To: 0x13e},
+ 17: {From: 0x141, To: 0x133},
+ 18: {From: 0x15d, To: 0x15e},
+ 19: {From: 0x163, To: 0x4b},
+}
+
+// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+// codes indicating collections of regions.
+// Size: 716 bytes, 358 elements
+var m49 = [358]int16{
+ // Entry 0 - 3F
+ 0, 1, 2, 3, 5, 9, 11, 13,
+ 14, 15, 17, 18, 19, 21, 29, 30,
+ 34, 35, 39, 53, 54, 57, 61, 142,
+ 143, 145, 150, 151, 154, 155, 202, 419,
+ 958, 0, 20, 784, 4, 28, 660, 8,
+ 51, 530, 24, 10, 32, 16, 40, 36,
+ 533, 248, 31, 70, 52, 50, 56, 854,
+ 100, 48, 108, 204, 652, 60, 96, 68,
+ // Entry 40 - 7F
+ 535, 76, 44, 64, 104, 74, 72, 112,
+ 84, 124, 166, 180, 140, 178, 756, 384,
+ 184, 152, 120, 156, 170, 0, 188, 891,
+ 296, 192, 132, 531, 162, 196, 203, 278,
+ 276, 0, 262, 208, 212, 214, 204, 12,
+ 0, 218, 233, 818, 732, 232, 724, 231,
+ 967, 0, 246, 242, 238, 583, 234, 0,
+ 250, 249, 266, 826, 308, 268, 254, 831,
+ // Entry 80 - BF
+ 288, 292, 304, 270, 324, 312, 226, 300,
+ 239, 320, 316, 624, 328, 344, 334, 340,
+ 191, 332, 348, 854, 0, 360, 372, 376,
+ 833, 356, 86, 368, 364, 352, 380, 832,
+ 388, 400, 392, 581, 404, 417, 116, 296,
+ 174, 659, 408, 410, 414, 136, 398, 418,
+ 422, 662, 438, 144, 430, 426, 440, 442,
+ 428, 434, 504, 492, 498, 499, 663, 450,
+ // Entry C0 - FF
+ 584, 581, 807, 466, 104, 496, 446, 580,
+ 474, 478, 500, 470, 480, 462, 454, 484,
+ 458, 508, 516, 540, 562, 574, 566, 548,
+ 558, 528, 578, 524, 10, 520, 536, 570,
+ 554, 512, 591, 0, 604, 258, 598, 608,
+ 586, 616, 666, 612, 630, 275, 620, 581,
+ 585, 600, 591, 634, 959, 960, 961, 962,
+ 963, 964, 965, 966, 967, 968, 969, 970,
+ // Entry 100 - 13F
+ 971, 972, 638, 716, 642, 688, 643, 646,
+ 682, 90, 690, 729, 752, 702, 654, 705,
+ 744, 703, 694, 674, 686, 706, 740, 728,
+ 678, 810, 222, 534, 760, 748, 0, 796,
+ 148, 260, 768, 764, 762, 772, 626, 795,
+ 788, 776, 626, 792, 780, 798, 158, 834,
+ 804, 800, 826, 581, 0, 840, 858, 860,
+ 336, 670, 704, 862, 92, 850, 704, 548,
+ // Entry 140 - 17F
+ 876, 581, 882, 973, 974, 975, 976, 977,
+ 978, 979, 980, 981, 982, 983, 984, 985,
+ 986, 987, 988, 989, 990, 991, 992, 993,
+ 994, 995, 996, 997, 998, 720, 887, 175,
+ 891, 710, 894, 180, 716, 999,
+}
+
+// m49Index gives indexes into fromM49 based on the three most significant bits
+// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+// The region code is stored in the 9 lsb of the indexed value.
+// Size: 18 bytes, 9 elements
+var m49Index = [9]int16{
+ 0, 59, 108, 143, 181, 220, 259, 291,
+ 333,
+}
+
+// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
+// Size: 666 bytes, 333 elements
+var fromM49 = [333]uint16{
+ // Entry 0 - 3F
+ 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
+ 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
+ 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
+ 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
+ 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
+ 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
+ 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
+ 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
+ // Entry 40 - 7F
+ 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
+ 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
+ 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
+ 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
+ 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
+ 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
+ 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
+ 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
+ // Entry 80 - BF
+ 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
+ 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
+ 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
+ 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
+ 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
+ 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
+ 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
+ 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
+ // Entry C0 - FF
+ 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
+ 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
+ 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
+ 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
+ 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
+ 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
+ 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
+ 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
+ // Entry 100 - 13F
+ 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
+ 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
+ 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
+ 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
+ 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
+ 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
+ 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
+ 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
+ // Entry 140 - 17F
+ 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
+ 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
+}
+
+// Size: 1615 bytes
+var variantIndex = map[string]uint8{
+ "1606nict": 0x0,
+ "1694acad": 0x1,
+ "1901": 0x2,
+ "1959acad": 0x3,
+ "1994": 0x4d,
+ "1996": 0x4,
+ "abl1943": 0x5,
+ "akuapem": 0x6,
+ "alalc97": 0x4f,
+ "aluku": 0x7,
+ "ao1990": 0x8,
+ "arevela": 0x9,
+ "arevmda": 0xa,
+ "asante": 0xb,
+ "baku1926": 0xc,
+ "balanka": 0xd,
+ "barla": 0xe,
+ "basiceng": 0xf,
+ "bauddha": 0x10,
+ "biscayan": 0x11,
+ "biske": 0x48,
+ "bohoric": 0x12,
+ "boont": 0x13,
+ "colb1945": 0x14,
+ "cornu": 0x15,
+ "dajnko": 0x16,
+ "ekavsk": 0x17,
+ "emodeng": 0x18,
+ "fonipa": 0x50,
+ "fonnapa": 0x51,
+ "fonupa": 0x52,
+ "fonxsamp": 0x53,
+ "hepburn": 0x19,
+ "heploc": 0x4e,
+ "hognorsk": 0x1a,
+ "hsistemo": 0x1b,
+ "ijekavsk": 0x1c,
+ "itihasa": 0x1d,
+ "jauer": 0x1e,
+ "jyutping": 0x1f,
+ "kkcor": 0x20,
+ "kociewie": 0x21,
+ "kscor": 0x22,
+ "laukika": 0x23,
+ "lipaw": 0x49,
+ "luna1918": 0x24,
+ "metelko": 0x25,
+ "monoton": 0x26,
+ "ndyuka": 0x27,
+ "nedis": 0x28,
+ "newfound": 0x29,
+ "njiva": 0x4a,
+ "nulik": 0x2a,
+ "osojs": 0x4b,
+ "oxendict": 0x2b,
+ "pahawh2": 0x2c,
+ "pahawh3": 0x2d,
+ "pahawh4": 0x2e,
+ "pamaka": 0x2f,
+ "petr1708": 0x30,
+ "pinyin": 0x31,
+ "polyton": 0x32,
+ "puter": 0x33,
+ "rigik": 0x34,
+ "rozaj": 0x35,
+ "rumgr": 0x36,
+ "scotland": 0x37,
+ "scouse": 0x38,
+ "simple": 0x54,
+ "solba": 0x4c,
+ "sotav": 0x39,
+ "spanglis": 0x3a,
+ "surmiran": 0x3b,
+ "sursilv": 0x3c,
+ "sutsilv": 0x3d,
+ "tarask": 0x3e,
+ "uccor": 0x3f,
+ "ucrcor": 0x40,
+ "ulster": 0x41,
+ "unifon": 0x42,
+ "vaidika": 0x43,
+ "valencia": 0x44,
+ "vallader": 0x45,
+ "wadegile": 0x46,
+ "xsistemo": 0x47,
+}
+
+// variantNumSpecialized is the number of specialized variants in variants.
+const variantNumSpecialized = 79
+
+// nRegionGroups is the number of region groups.
+const nRegionGroups = 33
+
+type likelyLangRegion struct {
+ lang uint16
+ region uint16
+}
+
+// likelyScript is a lookup table, indexed by scriptID, for the most likely
+// languages and regions given a script.
+// Size: 976 bytes, 244 elements
+var likelyScript = [244]likelyLangRegion{
+ 1: {lang: 0x14e, region: 0x84},
+ 3: {lang: 0x2a2, region: 0x106},
+ 4: {lang: 0x1f, region: 0x99},
+ 5: {lang: 0x3a, region: 0x6b},
+ 7: {lang: 0x3b, region: 0x9c},
+ 8: {lang: 0x1d7, region: 0x28},
+ 9: {lang: 0x13, region: 0x9c},
+ 10: {lang: 0x5b, region: 0x95},
+ 11: {lang: 0x60, region: 0x52},
+ 12: {lang: 0xb9, region: 0xb4},
+ 13: {lang: 0x63, region: 0x95},
+ 14: {lang: 0xa5, region: 0x35},
+ 15: {lang: 0x3e9, region: 0x99},
+ 17: {lang: 0x529, region: 0x12e},
+ 18: {lang: 0x3b1, region: 0x99},
+ 19: {lang: 0x15e, region: 0x78},
+ 20: {lang: 0xc2, region: 0x95},
+ 21: {lang: 0x9d, region: 0xe7},
+ 22: {lang: 0xdb, region: 0x35},
+ 23: {lang: 0xf3, region: 0x49},
+ 24: {lang: 0x4f0, region: 0x12b},
+ 25: {lang: 0xe7, region: 0x13e},
+ 26: {lang: 0xe5, region: 0x135},
+ 28: {lang: 0xf1, region: 0x6b},
+ 30: {lang: 0x1a0, region: 0x5d},
+ 31: {lang: 0x3e2, region: 0x106},
+ 33: {lang: 0x1be, region: 0x99},
+ 36: {lang: 0x15e, region: 0x78},
+ 39: {lang: 0x133, region: 0x6b},
+ 40: {lang: 0x431, region: 0x27},
+ 41: {lang: 0x27, region: 0x6f},
+ 43: {lang: 0x210, region: 0x7d},
+ 44: {lang: 0xfe, region: 0x38},
+ 46: {lang: 0x19b, region: 0x99},
+ 47: {lang: 0x19e, region: 0x130},
+ 48: {lang: 0x3e9, region: 0x99},
+ 49: {lang: 0x136, region: 0x87},
+ 50: {lang: 0x1a4, region: 0x99},
+ 51: {lang: 0x39d, region: 0x99},
+ 52: {lang: 0x529, region: 0x12e},
+ 53: {lang: 0x254, region: 0xab},
+ 54: {lang: 0x529, region: 0x53},
+ 55: {lang: 0x1cb, region: 0xe7},
+ 56: {lang: 0x529, region: 0x53},
+ 57: {lang: 0x529, region: 0x12e},
+ 58: {lang: 0x2fd, region: 0x9b},
+ 59: {lang: 0x1bc, region: 0x97},
+ 60: {lang: 0x200, region: 0xa2},
+ 61: {lang: 0x1c5, region: 0x12b},
+ 62: {lang: 0x1ca, region: 0xaf},
+ 65: {lang: 0x1d5, region: 0x92},
+ 67: {lang: 0x142, region: 0x9e},
+ 68: {lang: 0x254, region: 0xab},
+ 69: {lang: 0x20e, region: 0x95},
+ 70: {lang: 0x200, region: 0xa2},
+ 72: {lang: 0x135, region: 0xc4},
+ 73: {lang: 0x200, region: 0xa2},
+ 74: {lang: 0x3bb, region: 0xe8},
+ 75: {lang: 0x24a, region: 0xa6},
+ 76: {lang: 0x3fa, region: 0x99},
+ 79: {lang: 0x251, region: 0x99},
+ 80: {lang: 0x254, region: 0xab},
+ 82: {lang: 0x88, region: 0x99},
+ 83: {lang: 0x370, region: 0x123},
+ 84: {lang: 0x2b8, region: 0xaf},
+ 89: {lang: 0x29f, region: 0x99},
+ 90: {lang: 0x2a8, region: 0x99},
+ 91: {lang: 0x28f, region: 0x87},
+ 92: {lang: 0x1a0, region: 0x87},
+ 93: {lang: 0x2ac, region: 0x53},
+ 95: {lang: 0x4f4, region: 0x12b},
+ 96: {lang: 0x4f5, region: 0x12b},
+ 97: {lang: 0x1be, region: 0x99},
+ 99: {lang: 0x337, region: 0x9c},
+ 100: {lang: 0x4f7, region: 0x53},
+ 101: {lang: 0xa9, region: 0x53},
+ 104: {lang: 0x2e8, region: 0x112},
+ 105: {lang: 0x4f8, region: 0x10b},
+ 106: {lang: 0x4f8, region: 0x10b},
+ 107: {lang: 0x304, region: 0x99},
+ 108: {lang: 0x31b, region: 0x99},
+ 109: {lang: 0x30b, region: 0x53},
+ 111: {lang: 0x31e, region: 0x35},
+ 112: {lang: 0x30e, region: 0x99},
+ 113: {lang: 0x414, region: 0xe8},
+ 114: {lang: 0x331, region: 0xc4},
+ 115: {lang: 0x4f9, region: 0x108},
+ 116: {lang: 0x3b, region: 0xa1},
+ 117: {lang: 0x353, region: 0xdb},
+ 120: {lang: 0x2d0, region: 0x84},
+ 121: {lang: 0x52a, region: 0x53},
+ 122: {lang: 0x403, region: 0x96},
+ 123: {lang: 0x3ee, region: 0x99},
+ 124: {lang: 0x39b, region: 0xc5},
+ 125: {lang: 0x395, region: 0x99},
+ 126: {lang: 0x399, region: 0x135},
+ 127: {lang: 0x429, region: 0x115},
+ 128: {lang: 0x3b, region: 0x11c},
+ 129: {lang: 0xfd, region: 0xc4},
+ 130: {lang: 0x27d, region: 0x106},
+ 131: {lang: 0x2c9, region: 0x53},
+ 132: {lang: 0x39f, region: 0x9c},
+ 133: {lang: 0x39f, region: 0x53},
+ 135: {lang: 0x3ad, region: 0xb0},
+ 137: {lang: 0x1c6, region: 0x53},
+ 138: {lang: 0x4fd, region: 0x9c},
+ 189: {lang: 0x3cb, region: 0x95},
+ 191: {lang: 0x372, region: 0x10c},
+ 192: {lang: 0x420, region: 0x97},
+ 194: {lang: 0x4ff, region: 0x15e},
+ 195: {lang: 0x3f0, region: 0x99},
+ 196: {lang: 0x45, region: 0x135},
+ 197: {lang: 0x139, region: 0x7b},
+ 198: {lang: 0x3e9, region: 0x99},
+ 200: {lang: 0x3e9, region: 0x99},
+ 201: {lang: 0x3fa, region: 0x99},
+ 202: {lang: 0x40c, region: 0xb3},
+ 203: {lang: 0x433, region: 0x99},
+ 204: {lang: 0xef, region: 0xc5},
+ 205: {lang: 0x43e, region: 0x95},
+ 206: {lang: 0x44d, region: 0x35},
+ 207: {lang: 0x44e, region: 0x9b},
+ 211: {lang: 0x45a, region: 0xe7},
+ 212: {lang: 0x11a, region: 0x99},
+ 213: {lang: 0x45e, region: 0x53},
+ 214: {lang: 0x232, region: 0x53},
+ 215: {lang: 0x450, region: 0x99},
+ 216: {lang: 0x4a5, region: 0x53},
+ 217: {lang: 0x9f, region: 0x13e},
+ 218: {lang: 0x461, region: 0x99},
+ 220: {lang: 0x528, region: 0xba},
+ 221: {lang: 0x153, region: 0xe7},
+ 222: {lang: 0x128, region: 0xcd},
+ 223: {lang: 0x46b, region: 0x123},
+ 224: {lang: 0xa9, region: 0x53},
+ 225: {lang: 0x2ce, region: 0x99},
+ 226: {lang: 0x4ad, region: 0x11c},
+ 227: {lang: 0x4be, region: 0xb4},
+ 229: {lang: 0x1ce, region: 0x99},
+ 232: {lang: 0x3a9, region: 0x9c},
+ 233: {lang: 0x22, region: 0x9b},
+ 234: {lang: 0x1ea, region: 0x53},
+ 235: {lang: 0xef, region: 0xc5},
+}
+
+type likelyScriptRegion struct {
+ region uint16
+ script uint8
+ flags uint8
+}
+
+// likelyLang is a lookup table, indexed by langID, for the most likely
+// scripts and regions given incomplete information. If more entries exist for a
+// given language, region and script are the index and size respectively
+// of the list in likelyLangList.
+// Size: 5320 bytes, 1330 elements
+var likelyLang = [1330]likelyScriptRegion{
+ 0: {region: 0x135, script: 0x57, flags: 0x0},
+ 1: {region: 0x6f, script: 0x57, flags: 0x0},
+ 2: {region: 0x165, script: 0x57, flags: 0x0},
+ 3: {region: 0x165, script: 0x57, flags: 0x0},
+ 4: {region: 0x165, script: 0x57, flags: 0x0},
+ 5: {region: 0x7d, script: 0x1f, flags: 0x0},
+ 6: {region: 0x165, script: 0x57, flags: 0x0},
+ 7: {region: 0x165, script: 0x1f, flags: 0x0},
+ 8: {region: 0x80, script: 0x57, flags: 0x0},
+ 9: {region: 0x165, script: 0x57, flags: 0x0},
+ 10: {region: 0x165, script: 0x57, flags: 0x0},
+ 11: {region: 0x165, script: 0x57, flags: 0x0},
+ 12: {region: 0x95, script: 0x57, flags: 0x0},
+ 13: {region: 0x131, script: 0x57, flags: 0x0},
+ 14: {region: 0x80, script: 0x57, flags: 0x0},
+ 15: {region: 0x165, script: 0x57, flags: 0x0},
+ 16: {region: 0x165, script: 0x57, flags: 0x0},
+ 17: {region: 0x106, script: 0x1f, flags: 0x0},
+ 18: {region: 0x165, script: 0x57, flags: 0x0},
+ 19: {region: 0x9c, script: 0x9, flags: 0x0},
+ 20: {region: 0x128, script: 0x5, flags: 0x0},
+ 21: {region: 0x165, script: 0x57, flags: 0x0},
+ 22: {region: 0x161, script: 0x57, flags: 0x0},
+ 23: {region: 0x165, script: 0x57, flags: 0x0},
+ 24: {region: 0x165, script: 0x57, flags: 0x0},
+ 25: {region: 0x165, script: 0x57, flags: 0x0},
+ 26: {region: 0x165, script: 0x57, flags: 0x0},
+ 27: {region: 0x165, script: 0x57, flags: 0x0},
+ 28: {region: 0x52, script: 0x57, flags: 0x0},
+ 29: {region: 0x165, script: 0x57, flags: 0x0},
+ 30: {region: 0x165, script: 0x57, flags: 0x0},
+ 31: {region: 0x99, script: 0x4, flags: 0x0},
+ 32: {region: 0x165, script: 0x57, flags: 0x0},
+ 33: {region: 0x80, script: 0x57, flags: 0x0},
+ 34: {region: 0x9b, script: 0xe9, flags: 0x0},
+ 35: {region: 0x165, script: 0x57, flags: 0x0},
+ 36: {region: 0x165, script: 0x57, flags: 0x0},
+ 37: {region: 0x14d, script: 0x57, flags: 0x0},
+ 38: {region: 0x106, script: 0x1f, flags: 0x0},
+ 39: {region: 0x6f, script: 0x29, flags: 0x0},
+ 40: {region: 0x165, script: 0x57, flags: 0x0},
+ 41: {region: 0x165, script: 0x57, flags: 0x0},
+ 42: {region: 0xd6, script: 0x57, flags: 0x0},
+ 43: {region: 0x165, script: 0x57, flags: 0x0},
+ 45: {region: 0x165, script: 0x57, flags: 0x0},
+ 46: {region: 0x165, script: 0x57, flags: 0x0},
+ 47: {region: 0x165, script: 0x57, flags: 0x0},
+ 48: {region: 0x165, script: 0x57, flags: 0x0},
+ 49: {region: 0x165, script: 0x57, flags: 0x0},
+ 50: {region: 0x165, script: 0x57, flags: 0x0},
+ 51: {region: 0x95, script: 0x57, flags: 0x0},
+ 52: {region: 0x165, script: 0x5, flags: 0x0},
+ 53: {region: 0x122, script: 0x5, flags: 0x0},
+ 54: {region: 0x165, script: 0x57, flags: 0x0},
+ 55: {region: 0x165, script: 0x57, flags: 0x0},
+ 56: {region: 0x165, script: 0x57, flags: 0x0},
+ 57: {region: 0x165, script: 0x57, flags: 0x0},
+ 58: {region: 0x6b, script: 0x5, flags: 0x0},
+ 59: {region: 0x0, script: 0x3, flags: 0x1},
+ 60: {region: 0x165, script: 0x57, flags: 0x0},
+ 61: {region: 0x51, script: 0x57, flags: 0x0},
+ 62: {region: 0x3f, script: 0x57, flags: 0x0},
+ 63: {region: 0x67, script: 0x5, flags: 0x0},
+ 65: {region: 0xba, script: 0x5, flags: 0x0},
+ 66: {region: 0x6b, script: 0x5, flags: 0x0},
+ 67: {region: 0x99, script: 0xe, flags: 0x0},
+ 68: {region: 0x12f, script: 0x57, flags: 0x0},
+ 69: {region: 0x135, script: 0xc4, flags: 0x0},
+ 70: {region: 0x165, script: 0x57, flags: 0x0},
+ 71: {region: 0x165, script: 0x57, flags: 0x0},
+ 72: {region: 0x6e, script: 0x57, flags: 0x0},
+ 73: {region: 0x165, script: 0x57, flags: 0x0},
+ 74: {region: 0x165, script: 0x57, flags: 0x0},
+ 75: {region: 0x49, script: 0x57, flags: 0x0},
+ 76: {region: 0x165, script: 0x57, flags: 0x0},
+ 77: {region: 0x106, script: 0x1f, flags: 0x0},
+ 78: {region: 0x165, script: 0x5, flags: 0x0},
+ 79: {region: 0x165, script: 0x57, flags: 0x0},
+ 80: {region: 0x165, script: 0x57, flags: 0x0},
+ 81: {region: 0x165, script: 0x57, flags: 0x0},
+ 82: {region: 0x99, script: 0x21, flags: 0x0},
+ 83: {region: 0x165, script: 0x57, flags: 0x0},
+ 84: {region: 0x165, script: 0x57, flags: 0x0},
+ 85: {region: 0x165, script: 0x57, flags: 0x0},
+ 86: {region: 0x3f, script: 0x57, flags: 0x0},
+ 87: {region: 0x165, script: 0x57, flags: 0x0},
+ 88: {region: 0x3, script: 0x5, flags: 0x1},
+ 89: {region: 0x106, script: 0x1f, flags: 0x0},
+ 90: {region: 0xe8, script: 0x5, flags: 0x0},
+ 91: {region: 0x95, script: 0x57, flags: 0x0},
+ 92: {region: 0xdb, script: 0x21, flags: 0x0},
+ 93: {region: 0x2e, script: 0x57, flags: 0x0},
+ 94: {region: 0x52, script: 0x57, flags: 0x0},
+ 95: {region: 0x165, script: 0x57, flags: 0x0},
+ 96: {region: 0x52, script: 0xb, flags: 0x0},
+ 97: {region: 0x165, script: 0x57, flags: 0x0},
+ 98: {region: 0x165, script: 0x57, flags: 0x0},
+ 99: {region: 0x95, script: 0x57, flags: 0x0},
+ 100: {region: 0x165, script: 0x57, flags: 0x0},
+ 101: {region: 0x52, script: 0x57, flags: 0x0},
+ 102: {region: 0x165, script: 0x57, flags: 0x0},
+ 103: {region: 0x165, script: 0x57, flags: 0x0},
+ 104: {region: 0x165, script: 0x57, flags: 0x0},
+ 105: {region: 0x165, script: 0x57, flags: 0x0},
+ 106: {region: 0x4f, script: 0x57, flags: 0x0},
+ 107: {region: 0x165, script: 0x57, flags: 0x0},
+ 108: {region: 0x165, script: 0x57, flags: 0x0},
+ 109: {region: 0x165, script: 0x57, flags: 0x0},
+ 110: {region: 0x165, script: 0x29, flags: 0x0},
+ 111: {region: 0x165, script: 0x57, flags: 0x0},
+ 112: {region: 0x165, script: 0x57, flags: 0x0},
+ 113: {region: 0x47, script: 0x1f, flags: 0x0},
+ 114: {region: 0x165, script: 0x57, flags: 0x0},
+ 115: {region: 0x165, script: 0x57, flags: 0x0},
+ 116: {region: 0x10b, script: 0x5, flags: 0x0},
+ 117: {region: 0x162, script: 0x57, flags: 0x0},
+ 118: {region: 0x165, script: 0x57, flags: 0x0},
+ 119: {region: 0x95, script: 0x57, flags: 0x0},
+ 120: {region: 0x165, script: 0x57, flags: 0x0},
+ 121: {region: 0x12f, script: 0x57, flags: 0x0},
+ 122: {region: 0x52, script: 0x57, flags: 0x0},
+ 123: {region: 0x99, script: 0xd7, flags: 0x0},
+ 124: {region: 0xe8, script: 0x5, flags: 0x0},
+ 125: {region: 0x99, script: 0x21, flags: 0x0},
+ 126: {region: 0x38, script: 0x1f, flags: 0x0},
+ 127: {region: 0x99, script: 0x21, flags: 0x0},
+ 128: {region: 0xe8, script: 0x5, flags: 0x0},
+ 129: {region: 0x12b, script: 0x31, flags: 0x0},
+ 131: {region: 0x99, script: 0x21, flags: 0x0},
+ 132: {region: 0x165, script: 0x57, flags: 0x0},
+ 133: {region: 0x99, script: 0x21, flags: 0x0},
+ 134: {region: 0xe7, script: 0x57, flags: 0x0},
+ 135: {region: 0x165, script: 0x57, flags: 0x0},
+ 136: {region: 0x99, script: 0x21, flags: 0x0},
+ 137: {region: 0x165, script: 0x57, flags: 0x0},
+ 138: {region: 0x13f, script: 0x57, flags: 0x0},
+ 139: {region: 0x165, script: 0x57, flags: 0x0},
+ 140: {region: 0x165, script: 0x57, flags: 0x0},
+ 141: {region: 0xe7, script: 0x57, flags: 0x0},
+ 142: {region: 0x165, script: 0x57, flags: 0x0},
+ 143: {region: 0xd6, script: 0x57, flags: 0x0},
+ 144: {region: 0x165, script: 0x57, flags: 0x0},
+ 145: {region: 0x165, script: 0x57, flags: 0x0},
+ 146: {region: 0x165, script: 0x57, flags: 0x0},
+ 147: {region: 0x165, script: 0x29, flags: 0x0},
+ 148: {region: 0x99, script: 0x21, flags: 0x0},
+ 149: {region: 0x95, script: 0x57, flags: 0x0},
+ 150: {region: 0x165, script: 0x57, flags: 0x0},
+ 151: {region: 0x165, script: 0x57, flags: 0x0},
+ 152: {region: 0x114, script: 0x57, flags: 0x0},
+ 153: {region: 0x165, script: 0x57, flags: 0x0},
+ 154: {region: 0x165, script: 0x57, flags: 0x0},
+ 155: {region: 0x52, script: 0x57, flags: 0x0},
+ 156: {region: 0x165, script: 0x57, flags: 0x0},
+ 157: {region: 0xe7, script: 0x57, flags: 0x0},
+ 158: {region: 0x165, script: 0x57, flags: 0x0},
+ 159: {region: 0x13e, script: 0xd9, flags: 0x0},
+ 160: {region: 0xc3, script: 0x57, flags: 0x0},
+ 161: {region: 0x165, script: 0x57, flags: 0x0},
+ 162: {region: 0x165, script: 0x57, flags: 0x0},
+ 163: {region: 0xc3, script: 0x57, flags: 0x0},
+ 164: {region: 0x165, script: 0x57, flags: 0x0},
+ 165: {region: 0x35, script: 0xe, flags: 0x0},
+ 166: {region: 0x165, script: 0x57, flags: 0x0},
+ 167: {region: 0x165, script: 0x57, flags: 0x0},
+ 168: {region: 0x165, script: 0x57, flags: 0x0},
+ 169: {region: 0x53, script: 0xe0, flags: 0x0},
+ 170: {region: 0x165, script: 0x57, flags: 0x0},
+ 171: {region: 0x165, script: 0x57, flags: 0x0},
+ 172: {region: 0x165, script: 0x57, flags: 0x0},
+ 173: {region: 0x99, script: 0xe, flags: 0x0},
+ 174: {region: 0x165, script: 0x57, flags: 0x0},
+ 175: {region: 0x9c, script: 0x5, flags: 0x0},
+ 176: {region: 0x165, script: 0x57, flags: 0x0},
+ 177: {region: 0x4f, script: 0x57, flags: 0x0},
+ 178: {region: 0x78, script: 0x57, flags: 0x0},
+ 179: {region: 0x99, script: 0x21, flags: 0x0},
+ 180: {region: 0xe8, script: 0x5, flags: 0x0},
+ 181: {region: 0x99, script: 0x21, flags: 0x0},
+ 182: {region: 0x165, script: 0x57, flags: 0x0},
+ 183: {region: 0x33, script: 0x57, flags: 0x0},
+ 184: {region: 0x165, script: 0x57, flags: 0x0},
+ 185: {region: 0xb4, script: 0xc, flags: 0x0},
+ 186: {region: 0x52, script: 0x57, flags: 0x0},
+ 187: {region: 0x165, script: 0x29, flags: 0x0},
+ 188: {region: 0xe7, script: 0x57, flags: 0x0},
+ 189: {region: 0x165, script: 0x57, flags: 0x0},
+ 190: {region: 0xe8, script: 0x21, flags: 0x0},
+ 191: {region: 0x106, script: 0x1f, flags: 0x0},
+ 192: {region: 0x15f, script: 0x57, flags: 0x0},
+ 193: {region: 0x165, script: 0x57, flags: 0x0},
+ 194: {region: 0x95, script: 0x57, flags: 0x0},
+ 195: {region: 0x165, script: 0x57, flags: 0x0},
+ 196: {region: 0x52, script: 0x57, flags: 0x0},
+ 197: {region: 0x165, script: 0x57, flags: 0x0},
+ 198: {region: 0x165, script: 0x57, flags: 0x0},
+ 199: {region: 0x165, script: 0x57, flags: 0x0},
+ 200: {region: 0x86, script: 0x57, flags: 0x0},
+ 201: {region: 0x165, script: 0x57, flags: 0x0},
+ 202: {region: 0x165, script: 0x57, flags: 0x0},
+ 203: {region: 0x165, script: 0x57, flags: 0x0},
+ 204: {region: 0x165, script: 0x57, flags: 0x0},
+ 205: {region: 0x6d, script: 0x29, flags: 0x0},
+ 206: {region: 0x165, script: 0x57, flags: 0x0},
+ 207: {region: 0x165, script: 0x57, flags: 0x0},
+ 208: {region: 0x52, script: 0x57, flags: 0x0},
+ 209: {region: 0x165, script: 0x57, flags: 0x0},
+ 210: {region: 0x165, script: 0x57, flags: 0x0},
+ 211: {region: 0xc3, script: 0x57, flags: 0x0},
+ 212: {region: 0x165, script: 0x57, flags: 0x0},
+ 213: {region: 0x165, script: 0x57, flags: 0x0},
+ 214: {region: 0x165, script: 0x57, flags: 0x0},
+ 215: {region: 0x6e, script: 0x57, flags: 0x0},
+ 216: {region: 0x165, script: 0x57, flags: 0x0},
+ 217: {region: 0x165, script: 0x57, flags: 0x0},
+ 218: {region: 0xd6, script: 0x57, flags: 0x0},
+ 219: {region: 0x35, script: 0x16, flags: 0x0},
+ 220: {region: 0x106, script: 0x1f, flags: 0x0},
+ 221: {region: 0xe7, script: 0x57, flags: 0x0},
+ 222: {region: 0x165, script: 0x57, flags: 0x0},
+ 223: {region: 0x131, script: 0x57, flags: 0x0},
+ 224: {region: 0x8a, script: 0x57, flags: 0x0},
+ 225: {region: 0x75, script: 0x57, flags: 0x0},
+ 226: {region: 0x106, script: 0x1f, flags: 0x0},
+ 227: {region: 0x135, script: 0x57, flags: 0x0},
+ 228: {region: 0x49, script: 0x57, flags: 0x0},
+ 229: {region: 0x135, script: 0x1a, flags: 0x0},
+ 230: {region: 0xa6, script: 0x5, flags: 0x0},
+ 231: {region: 0x13e, script: 0x19, flags: 0x0},
+ 232: {region: 0x165, script: 0x57, flags: 0x0},
+ 233: {region: 0x9b, script: 0x5, flags: 0x0},
+ 234: {region: 0x165, script: 0x57, flags: 0x0},
+ 235: {region: 0x165, script: 0x57, flags: 0x0},
+ 236: {region: 0x165, script: 0x57, flags: 0x0},
+ 237: {region: 0x165, script: 0x57, flags: 0x0},
+ 238: {region: 0x165, script: 0x57, flags: 0x0},
+ 239: {region: 0xc5, script: 0xcc, flags: 0x0},
+ 240: {region: 0x78, script: 0x57, flags: 0x0},
+ 241: {region: 0x6b, script: 0x1c, flags: 0x0},
+ 242: {region: 0xe7, script: 0x57, flags: 0x0},
+ 243: {region: 0x49, script: 0x17, flags: 0x0},
+ 244: {region: 0x130, script: 0x1f, flags: 0x0},
+ 245: {region: 0x49, script: 0x17, flags: 0x0},
+ 246: {region: 0x49, script: 0x17, flags: 0x0},
+ 247: {region: 0x49, script: 0x17, flags: 0x0},
+ 248: {region: 0x49, script: 0x17, flags: 0x0},
+ 249: {region: 0x10a, script: 0x57, flags: 0x0},
+ 250: {region: 0x5e, script: 0x57, flags: 0x0},
+ 251: {region: 0xe9, script: 0x57, flags: 0x0},
+ 252: {region: 0x49, script: 0x17, flags: 0x0},
+ 253: {region: 0xc4, script: 0x81, flags: 0x0},
+ 254: {region: 0x8, script: 0x2, flags: 0x1},
+ 255: {region: 0x106, script: 0x1f, flags: 0x0},
+ 256: {region: 0x7b, script: 0x57, flags: 0x0},
+ 257: {region: 0x63, script: 0x57, flags: 0x0},
+ 258: {region: 0x165, script: 0x57, flags: 0x0},
+ 259: {region: 0x165, script: 0x57, flags: 0x0},
+ 260: {region: 0x165, script: 0x57, flags: 0x0},
+ 261: {region: 0x165, script: 0x57, flags: 0x0},
+ 262: {region: 0x135, script: 0x57, flags: 0x0},
+ 263: {region: 0x106, script: 0x1f, flags: 0x0},
+ 264: {region: 0xa4, script: 0x57, flags: 0x0},
+ 265: {region: 0x165, script: 0x57, flags: 0x0},
+ 266: {region: 0x165, script: 0x57, flags: 0x0},
+ 267: {region: 0x99, script: 0x5, flags: 0x0},
+ 268: {region: 0x165, script: 0x57, flags: 0x0},
+ 269: {region: 0x60, script: 0x57, flags: 0x0},
+ 270: {region: 0x165, script: 0x57, flags: 0x0},
+ 271: {region: 0x49, script: 0x57, flags: 0x0},
+ 272: {region: 0x165, script: 0x57, flags: 0x0},
+ 273: {region: 0x165, script: 0x57, flags: 0x0},
+ 274: {region: 0x165, script: 0x57, flags: 0x0},
+ 275: {region: 0x165, script: 0x5, flags: 0x0},
+ 276: {region: 0x49, script: 0x57, flags: 0x0},
+ 277: {region: 0x165, script: 0x57, flags: 0x0},
+ 278: {region: 0x165, script: 0x57, flags: 0x0},
+ 279: {region: 0xd4, script: 0x57, flags: 0x0},
+ 280: {region: 0x4f, script: 0x57, flags: 0x0},
+ 281: {region: 0x165, script: 0x57, flags: 0x0},
+ 282: {region: 0x99, script: 0x5, flags: 0x0},
+ 283: {region: 0x165, script: 0x57, flags: 0x0},
+ 284: {region: 0x165, script: 0x57, flags: 0x0},
+ 285: {region: 0x165, script: 0x57, flags: 0x0},
+ 286: {region: 0x165, script: 0x29, flags: 0x0},
+ 287: {region: 0x60, script: 0x57, flags: 0x0},
+ 288: {region: 0xc3, script: 0x57, flags: 0x0},
+ 289: {region: 0xd0, script: 0x57, flags: 0x0},
+ 290: {region: 0x165, script: 0x57, flags: 0x0},
+ 291: {region: 0xdb, script: 0x21, flags: 0x0},
+ 292: {region: 0x52, script: 0x57, flags: 0x0},
+ 293: {region: 0x165, script: 0x57, flags: 0x0},
+ 294: {region: 0x165, script: 0x57, flags: 0x0},
+ 295: {region: 0x165, script: 0x57, flags: 0x0},
+ 296: {region: 0xcd, script: 0xde, flags: 0x0},
+ 297: {region: 0x165, script: 0x57, flags: 0x0},
+ 298: {region: 0x165, script: 0x57, flags: 0x0},
+ 299: {region: 0x114, script: 0x57, flags: 0x0},
+ 300: {region: 0x37, script: 0x57, flags: 0x0},
+ 301: {region: 0x43, script: 0xe0, flags: 0x0},
+ 302: {region: 0x165, script: 0x57, flags: 0x0},
+ 303: {region: 0xa4, script: 0x57, flags: 0x0},
+ 304: {region: 0x80, script: 0x57, flags: 0x0},
+ 305: {region: 0xd6, script: 0x57, flags: 0x0},
+ 306: {region: 0x9e, script: 0x57, flags: 0x0},
+ 307: {region: 0x6b, script: 0x27, flags: 0x0},
+ 308: {region: 0x165, script: 0x57, flags: 0x0},
+ 309: {region: 0xc4, script: 0x48, flags: 0x0},
+ 310: {region: 0x87, script: 0x31, flags: 0x0},
+ 311: {region: 0x165, script: 0x57, flags: 0x0},
+ 312: {region: 0x165, script: 0x57, flags: 0x0},
+ 313: {region: 0xa, script: 0x2, flags: 0x1},
+ 314: {region: 0x165, script: 0x57, flags: 0x0},
+ 315: {region: 0x165, script: 0x57, flags: 0x0},
+ 316: {region: 0x1, script: 0x57, flags: 0x0},
+ 317: {region: 0x165, script: 0x57, flags: 0x0},
+ 318: {region: 0x6e, script: 0x57, flags: 0x0},
+ 319: {region: 0x135, script: 0x57, flags: 0x0},
+ 320: {region: 0x6a, script: 0x57, flags: 0x0},
+ 321: {region: 0x165, script: 0x57, flags: 0x0},
+ 322: {region: 0x9e, script: 0x43, flags: 0x0},
+ 323: {region: 0x165, script: 0x57, flags: 0x0},
+ 324: {region: 0x165, script: 0x57, flags: 0x0},
+ 325: {region: 0x6e, script: 0x57, flags: 0x0},
+ 326: {region: 0x52, script: 0x57, flags: 0x0},
+ 327: {region: 0x6e, script: 0x57, flags: 0x0},
+ 328: {region: 0x9c, script: 0x5, flags: 0x0},
+ 329: {region: 0x165, script: 0x57, flags: 0x0},
+ 330: {region: 0x165, script: 0x57, flags: 0x0},
+ 331: {region: 0x165, script: 0x57, flags: 0x0},
+ 332: {region: 0x165, script: 0x57, flags: 0x0},
+ 333: {region: 0x86, script: 0x57, flags: 0x0},
+ 334: {region: 0xc, script: 0x2, flags: 0x1},
+ 335: {region: 0x165, script: 0x57, flags: 0x0},
+ 336: {region: 0xc3, script: 0x57, flags: 0x0},
+ 337: {region: 0x72, script: 0x57, flags: 0x0},
+ 338: {region: 0x10b, script: 0x5, flags: 0x0},
+ 339: {region: 0xe7, script: 0x57, flags: 0x0},
+ 340: {region: 0x10c, script: 0x57, flags: 0x0},
+ 341: {region: 0x73, script: 0x57, flags: 0x0},
+ 342: {region: 0x165, script: 0x57, flags: 0x0},
+ 343: {region: 0x165, script: 0x57, flags: 0x0},
+ 344: {region: 0x76, script: 0x57, flags: 0x0},
+ 345: {region: 0x165, script: 0x57, flags: 0x0},
+ 346: {region: 0x3b, script: 0x57, flags: 0x0},
+ 347: {region: 0x165, script: 0x57, flags: 0x0},
+ 348: {region: 0x165, script: 0x57, flags: 0x0},
+ 349: {region: 0x165, script: 0x57, flags: 0x0},
+ 350: {region: 0x78, script: 0x57, flags: 0x0},
+ 351: {region: 0x135, script: 0x57, flags: 0x0},
+ 352: {region: 0x78, script: 0x57, flags: 0x0},
+ 353: {region: 0x60, script: 0x57, flags: 0x0},
+ 354: {region: 0x60, script: 0x57, flags: 0x0},
+ 355: {region: 0x52, script: 0x5, flags: 0x0},
+ 356: {region: 0x140, script: 0x57, flags: 0x0},
+ 357: {region: 0x165, script: 0x57, flags: 0x0},
+ 358: {region: 0x84, script: 0x57, flags: 0x0},
+ 359: {region: 0x165, script: 0x57, flags: 0x0},
+ 360: {region: 0xd4, script: 0x57, flags: 0x0},
+ 361: {region: 0x9e, script: 0x57, flags: 0x0},
+ 362: {region: 0xd6, script: 0x57, flags: 0x0},
+ 363: {region: 0x165, script: 0x57, flags: 0x0},
+ 364: {region: 0x10b, script: 0x57, flags: 0x0},
+ 365: {region: 0xd9, script: 0x57, flags: 0x0},
+ 366: {region: 0x96, script: 0x57, flags: 0x0},
+ 367: {region: 0x80, script: 0x57, flags: 0x0},
+ 368: {region: 0x165, script: 0x57, flags: 0x0},
+ 369: {region: 0xbc, script: 0x57, flags: 0x0},
+ 370: {region: 0x165, script: 0x57, flags: 0x0},
+ 371: {region: 0x165, script: 0x57, flags: 0x0},
+ 372: {region: 0x165, script: 0x57, flags: 0x0},
+ 373: {region: 0x53, script: 0x38, flags: 0x0},
+ 374: {region: 0x165, script: 0x57, flags: 0x0},
+ 375: {region: 0x95, script: 0x57, flags: 0x0},
+ 376: {region: 0x165, script: 0x57, flags: 0x0},
+ 377: {region: 0x165, script: 0x57, flags: 0x0},
+ 378: {region: 0x99, script: 0x21, flags: 0x0},
+ 379: {region: 0x165, script: 0x57, flags: 0x0},
+ 380: {region: 0x9c, script: 0x5, flags: 0x0},
+ 381: {region: 0x7e, script: 0x57, flags: 0x0},
+ 382: {region: 0x7b, script: 0x57, flags: 0x0},
+ 383: {region: 0x165, script: 0x57, flags: 0x0},
+ 384: {region: 0x165, script: 0x57, flags: 0x0},
+ 385: {region: 0x165, script: 0x57, flags: 0x0},
+ 386: {region: 0x165, script: 0x57, flags: 0x0},
+ 387: {region: 0x165, script: 0x57, flags: 0x0},
+ 388: {region: 0x165, script: 0x57, flags: 0x0},
+ 389: {region: 0x6f, script: 0x29, flags: 0x0},
+ 390: {region: 0x165, script: 0x57, flags: 0x0},
+ 391: {region: 0xdb, script: 0x21, flags: 0x0},
+ 392: {region: 0x165, script: 0x57, flags: 0x0},
+ 393: {region: 0xa7, script: 0x57, flags: 0x0},
+ 394: {region: 0x165, script: 0x57, flags: 0x0},
+ 395: {region: 0xe8, script: 0x5, flags: 0x0},
+ 396: {region: 0x165, script: 0x57, flags: 0x0},
+ 397: {region: 0xe8, script: 0x5, flags: 0x0},
+ 398: {region: 0x165, script: 0x57, flags: 0x0},
+ 399: {region: 0x165, script: 0x57, flags: 0x0},
+ 400: {region: 0x6e, script: 0x57, flags: 0x0},
+ 401: {region: 0x9c, script: 0x5, flags: 0x0},
+ 402: {region: 0x165, script: 0x57, flags: 0x0},
+ 403: {region: 0x165, script: 0x29, flags: 0x0},
+ 404: {region: 0xf1, script: 0x57, flags: 0x0},
+ 405: {region: 0x165, script: 0x57, flags: 0x0},
+ 406: {region: 0x165, script: 0x57, flags: 0x0},
+ 407: {region: 0x165, script: 0x57, flags: 0x0},
+ 408: {region: 0x165, script: 0x29, flags: 0x0},
+ 409: {region: 0x165, script: 0x57, flags: 0x0},
+ 410: {region: 0x99, script: 0x21, flags: 0x0},
+ 411: {region: 0x99, script: 0xda, flags: 0x0},
+ 412: {region: 0x95, script: 0x57, flags: 0x0},
+ 413: {region: 0xd9, script: 0x57, flags: 0x0},
+ 414: {region: 0x130, script: 0x2f, flags: 0x0},
+ 415: {region: 0x165, script: 0x57, flags: 0x0},
+ 416: {region: 0xe, script: 0x2, flags: 0x1},
+ 417: {region: 0x99, script: 0xe, flags: 0x0},
+ 418: {region: 0x165, script: 0x57, flags: 0x0},
+ 419: {region: 0x4e, script: 0x57, flags: 0x0},
+ 420: {region: 0x99, script: 0x32, flags: 0x0},
+ 421: {region: 0x41, script: 0x57, flags: 0x0},
+ 422: {region: 0x54, script: 0x57, flags: 0x0},
+ 423: {region: 0x165, script: 0x57, flags: 0x0},
+ 424: {region: 0x80, script: 0x57, flags: 0x0},
+ 425: {region: 0x165, script: 0x57, flags: 0x0},
+ 426: {region: 0x165, script: 0x57, flags: 0x0},
+ 427: {region: 0xa4, script: 0x57, flags: 0x0},
+ 428: {region: 0x98, script: 0x57, flags: 0x0},
+ 429: {region: 0x165, script: 0x57, flags: 0x0},
+ 430: {region: 0xdb, script: 0x21, flags: 0x0},
+ 431: {region: 0x165, script: 0x57, flags: 0x0},
+ 432: {region: 0x165, script: 0x5, flags: 0x0},
+ 433: {region: 0x49, script: 0x57, flags: 0x0},
+ 434: {region: 0x165, script: 0x5, flags: 0x0},
+ 435: {region: 0x165, script: 0x57, flags: 0x0},
+ 436: {region: 0x10, script: 0x3, flags: 0x1},
+ 437: {region: 0x165, script: 0x57, flags: 0x0},
+ 438: {region: 0x53, script: 0x38, flags: 0x0},
+ 439: {region: 0x165, script: 0x57, flags: 0x0},
+ 440: {region: 0x135, script: 0x57, flags: 0x0},
+ 441: {region: 0x24, script: 0x5, flags: 0x0},
+ 442: {region: 0x165, script: 0x57, flags: 0x0},
+ 443: {region: 0x165, script: 0x29, flags: 0x0},
+ 444: {region: 0x97, script: 0x3b, flags: 0x0},
+ 445: {region: 0x165, script: 0x57, flags: 0x0},
+ 446: {region: 0x99, script: 0x21, flags: 0x0},
+ 447: {region: 0x165, script: 0x57, flags: 0x0},
+ 448: {region: 0x73, script: 0x57, flags: 0x0},
+ 449: {region: 0x165, script: 0x57, flags: 0x0},
+ 450: {region: 0x165, script: 0x57, flags: 0x0},
+ 451: {region: 0xe7, script: 0x57, flags: 0x0},
+ 452: {region: 0x165, script: 0x57, flags: 0x0},
+ 453: {region: 0x12b, script: 0x3d, flags: 0x0},
+ 454: {region: 0x53, script: 0x89, flags: 0x0},
+ 455: {region: 0x165, script: 0x57, flags: 0x0},
+ 456: {region: 0xe8, script: 0x5, flags: 0x0},
+ 457: {region: 0x99, script: 0x21, flags: 0x0},
+ 458: {region: 0xaf, script: 0x3e, flags: 0x0},
+ 459: {region: 0xe7, script: 0x57, flags: 0x0},
+ 460: {region: 0xe8, script: 0x5, flags: 0x0},
+ 461: {region: 0xe6, script: 0x57, flags: 0x0},
+ 462: {region: 0x99, script: 0x21, flags: 0x0},
+ 463: {region: 0x99, script: 0x21, flags: 0x0},
+ 464: {region: 0x165, script: 0x57, flags: 0x0},
+ 465: {region: 0x90, script: 0x57, flags: 0x0},
+ 466: {region: 0x60, script: 0x57, flags: 0x0},
+ 467: {region: 0x53, script: 0x38, flags: 0x0},
+ 468: {region: 0x91, script: 0x57, flags: 0x0},
+ 469: {region: 0x92, script: 0x57, flags: 0x0},
+ 470: {region: 0x165, script: 0x57, flags: 0x0},
+ 471: {region: 0x28, script: 0x8, flags: 0x0},
+ 472: {region: 0xd2, script: 0x57, flags: 0x0},
+ 473: {region: 0x78, script: 0x57, flags: 0x0},
+ 474: {region: 0x165, script: 0x57, flags: 0x0},
+ 475: {region: 0x165, script: 0x57, flags: 0x0},
+ 476: {region: 0xd0, script: 0x57, flags: 0x0},
+ 477: {region: 0xd6, script: 0x57, flags: 0x0},
+ 478: {region: 0x165, script: 0x57, flags: 0x0},
+ 479: {region: 0x165, script: 0x57, flags: 0x0},
+ 480: {region: 0x165, script: 0x57, flags: 0x0},
+ 481: {region: 0x95, script: 0x57, flags: 0x0},
+ 482: {region: 0x165, script: 0x57, flags: 0x0},
+ 483: {region: 0x165, script: 0x57, flags: 0x0},
+ 484: {region: 0x165, script: 0x57, flags: 0x0},
+ 486: {region: 0x122, script: 0x57, flags: 0x0},
+ 487: {region: 0xd6, script: 0x57, flags: 0x0},
+ 488: {region: 0x165, script: 0x57, flags: 0x0},
+ 489: {region: 0x165, script: 0x57, flags: 0x0},
+ 490: {region: 0x53, script: 0xea, flags: 0x0},
+ 491: {region: 0x165, script: 0x57, flags: 0x0},
+ 492: {region: 0x135, script: 0x57, flags: 0x0},
+ 493: {region: 0x165, script: 0x57, flags: 0x0},
+ 494: {region: 0x49, script: 0x57, flags: 0x0},
+ 495: {region: 0x165, script: 0x57, flags: 0x0},
+ 496: {region: 0x165, script: 0x57, flags: 0x0},
+ 497: {region: 0xe7, script: 0x57, flags: 0x0},
+ 498: {region: 0x165, script: 0x57, flags: 0x0},
+ 499: {region: 0x95, script: 0x57, flags: 0x0},
+ 500: {region: 0x106, script: 0x1f, flags: 0x0},
+ 501: {region: 0x1, script: 0x57, flags: 0x0},
+ 502: {region: 0x165, script: 0x57, flags: 0x0},
+ 503: {region: 0x165, script: 0x57, flags: 0x0},
+ 504: {region: 0x9d, script: 0x57, flags: 0x0},
+ 505: {region: 0x9e, script: 0x57, flags: 0x0},
+ 506: {region: 0x49, script: 0x17, flags: 0x0},
+ 507: {region: 0x97, script: 0x3b, flags: 0x0},
+ 508: {region: 0x165, script: 0x57, flags: 0x0},
+ 509: {region: 0x165, script: 0x57, flags: 0x0},
+ 510: {region: 0x106, script: 0x57, flags: 0x0},
+ 511: {region: 0x165, script: 0x57, flags: 0x0},
+ 512: {region: 0xa2, script: 0x46, flags: 0x0},
+ 513: {region: 0x165, script: 0x57, flags: 0x0},
+ 514: {region: 0xa0, script: 0x57, flags: 0x0},
+ 515: {region: 0x1, script: 0x57, flags: 0x0},
+ 516: {region: 0x165, script: 0x57, flags: 0x0},
+ 517: {region: 0x165, script: 0x57, flags: 0x0},
+ 518: {region: 0x165, script: 0x57, flags: 0x0},
+ 519: {region: 0x52, script: 0x57, flags: 0x0},
+ 520: {region: 0x130, script: 0x3b, flags: 0x0},
+ 521: {region: 0x165, script: 0x57, flags: 0x0},
+ 522: {region: 0x12f, script: 0x57, flags: 0x0},
+ 523: {region: 0xdb, script: 0x21, flags: 0x0},
+ 524: {region: 0x165, script: 0x57, flags: 0x0},
+ 525: {region: 0x63, script: 0x57, flags: 0x0},
+ 526: {region: 0x95, script: 0x57, flags: 0x0},
+ 527: {region: 0x95, script: 0x57, flags: 0x0},
+ 528: {region: 0x7d, script: 0x2b, flags: 0x0},
+ 529: {region: 0x137, script: 0x1f, flags: 0x0},
+ 530: {region: 0x67, script: 0x57, flags: 0x0},
+ 531: {region: 0xc4, script: 0x57, flags: 0x0},
+ 532: {region: 0x165, script: 0x57, flags: 0x0},
+ 533: {region: 0x165, script: 0x57, flags: 0x0},
+ 534: {region: 0xd6, script: 0x57, flags: 0x0},
+ 535: {region: 0xa4, script: 0x57, flags: 0x0},
+ 536: {region: 0xc3, script: 0x57, flags: 0x0},
+ 537: {region: 0x106, script: 0x1f, flags: 0x0},
+ 538: {region: 0x165, script: 0x57, flags: 0x0},
+ 539: {region: 0x165, script: 0x57, flags: 0x0},
+ 540: {region: 0x165, script: 0x57, flags: 0x0},
+ 541: {region: 0x165, script: 0x57, flags: 0x0},
+ 542: {region: 0xd4, script: 0x5, flags: 0x0},
+ 543: {region: 0xd6, script: 0x57, flags: 0x0},
+ 544: {region: 0x164, script: 0x57, flags: 0x0},
+ 545: {region: 0x165, script: 0x57, flags: 0x0},
+ 546: {region: 0x165, script: 0x57, flags: 0x0},
+ 547: {region: 0x12f, script: 0x57, flags: 0x0},
+ 548: {region: 0x122, script: 0x5, flags: 0x0},
+ 549: {region: 0x165, script: 0x57, flags: 0x0},
+ 550: {region: 0x123, script: 0xdf, flags: 0x0},
+ 551: {region: 0x5a, script: 0x57, flags: 0x0},
+ 552: {region: 0x52, script: 0x57, flags: 0x0},
+ 553: {region: 0x165, script: 0x57, flags: 0x0},
+ 554: {region: 0x4f, script: 0x57, flags: 0x0},
+ 555: {region: 0x99, script: 0x21, flags: 0x0},
+ 556: {region: 0x99, script: 0x21, flags: 0x0},
+ 557: {region: 0x4b, script: 0x57, flags: 0x0},
+ 558: {region: 0x95, script: 0x57, flags: 0x0},
+ 559: {region: 0x165, script: 0x57, flags: 0x0},
+ 560: {region: 0x41, script: 0x57, flags: 0x0},
+ 561: {region: 0x99, script: 0x57, flags: 0x0},
+ 562: {region: 0x53, script: 0xd6, flags: 0x0},
+ 563: {region: 0x99, script: 0x21, flags: 0x0},
+ 564: {region: 0xc3, script: 0x57, flags: 0x0},
+ 565: {region: 0x165, script: 0x57, flags: 0x0},
+ 566: {region: 0x99, script: 0x72, flags: 0x0},
+ 567: {region: 0xe8, script: 0x5, flags: 0x0},
+ 568: {region: 0x165, script: 0x57, flags: 0x0},
+ 569: {region: 0xa4, script: 0x57, flags: 0x0},
+ 570: {region: 0x165, script: 0x57, flags: 0x0},
+ 571: {region: 0x12b, script: 0x57, flags: 0x0},
+ 572: {region: 0x165, script: 0x57, flags: 0x0},
+ 573: {region: 0xd2, script: 0x57, flags: 0x0},
+ 574: {region: 0x165, script: 0x57, flags: 0x0},
+ 575: {region: 0xaf, script: 0x54, flags: 0x0},
+ 576: {region: 0x165, script: 0x57, flags: 0x0},
+ 577: {region: 0x165, script: 0x57, flags: 0x0},
+ 578: {region: 0x13, script: 0x6, flags: 0x1},
+ 579: {region: 0x165, script: 0x57, flags: 0x0},
+ 580: {region: 0x52, script: 0x57, flags: 0x0},
+ 581: {region: 0x82, script: 0x57, flags: 0x0},
+ 582: {region: 0xa4, script: 0x57, flags: 0x0},
+ 583: {region: 0x165, script: 0x57, flags: 0x0},
+ 584: {region: 0x165, script: 0x57, flags: 0x0},
+ 585: {region: 0x165, script: 0x57, flags: 0x0},
+ 586: {region: 0xa6, script: 0x4b, flags: 0x0},
+ 587: {region: 0x2a, script: 0x57, flags: 0x0},
+ 588: {region: 0x165, script: 0x57, flags: 0x0},
+ 589: {region: 0x165, script: 0x57, flags: 0x0},
+ 590: {region: 0x165, script: 0x57, flags: 0x0},
+ 591: {region: 0x165, script: 0x57, flags: 0x0},
+ 592: {region: 0x165, script: 0x57, flags: 0x0},
+ 593: {region: 0x99, script: 0x4f, flags: 0x0},
+ 594: {region: 0x8b, script: 0x57, flags: 0x0},
+ 595: {region: 0x165, script: 0x57, flags: 0x0},
+ 596: {region: 0xab, script: 0x50, flags: 0x0},
+ 597: {region: 0x106, script: 0x1f, flags: 0x0},
+ 598: {region: 0x99, script: 0x21, flags: 0x0},
+ 599: {region: 0x165, script: 0x57, flags: 0x0},
+ 600: {region: 0x75, script: 0x57, flags: 0x0},
+ 601: {region: 0x165, script: 0x57, flags: 0x0},
+ 602: {region: 0xb4, script: 0x57, flags: 0x0},
+ 603: {region: 0x165, script: 0x57, flags: 0x0},
+ 604: {region: 0x165, script: 0x57, flags: 0x0},
+ 605: {region: 0x165, script: 0x57, flags: 0x0},
+ 606: {region: 0x165, script: 0x57, flags: 0x0},
+ 607: {region: 0x165, script: 0x57, flags: 0x0},
+ 608: {region: 0x165, script: 0x57, flags: 0x0},
+ 609: {region: 0x165, script: 0x57, flags: 0x0},
+ 610: {region: 0x165, script: 0x29, flags: 0x0},
+ 611: {region: 0x165, script: 0x57, flags: 0x0},
+ 612: {region: 0x106, script: 0x1f, flags: 0x0},
+ 613: {region: 0x112, script: 0x57, flags: 0x0},
+ 614: {region: 0xe7, script: 0x57, flags: 0x0},
+ 615: {region: 0x106, script: 0x57, flags: 0x0},
+ 616: {region: 0x165, script: 0x57, flags: 0x0},
+ 617: {region: 0x99, script: 0x21, flags: 0x0},
+ 618: {region: 0x99, script: 0x5, flags: 0x0},
+ 619: {region: 0x12f, script: 0x57, flags: 0x0},
+ 620: {region: 0x165, script: 0x57, flags: 0x0},
+ 621: {region: 0x52, script: 0x57, flags: 0x0},
+ 622: {region: 0x60, script: 0x57, flags: 0x0},
+ 623: {region: 0x165, script: 0x57, flags: 0x0},
+ 624: {region: 0x165, script: 0x57, flags: 0x0},
+ 625: {region: 0x165, script: 0x29, flags: 0x0},
+ 626: {region: 0x165, script: 0x57, flags: 0x0},
+ 627: {region: 0x165, script: 0x57, flags: 0x0},
+ 628: {region: 0x19, script: 0x3, flags: 0x1},
+ 629: {region: 0x165, script: 0x57, flags: 0x0},
+ 630: {region: 0x165, script: 0x57, flags: 0x0},
+ 631: {region: 0x165, script: 0x57, flags: 0x0},
+ 632: {region: 0x165, script: 0x57, flags: 0x0},
+ 633: {region: 0x106, script: 0x1f, flags: 0x0},
+ 634: {region: 0x165, script: 0x57, flags: 0x0},
+ 635: {region: 0x165, script: 0x57, flags: 0x0},
+ 636: {region: 0x165, script: 0x57, flags: 0x0},
+ 637: {region: 0x106, script: 0x1f, flags: 0x0},
+ 638: {region: 0x165, script: 0x57, flags: 0x0},
+ 639: {region: 0x95, script: 0x57, flags: 0x0},
+ 640: {region: 0xe8, script: 0x5, flags: 0x0},
+ 641: {region: 0x7b, script: 0x57, flags: 0x0},
+ 642: {region: 0x165, script: 0x57, flags: 0x0},
+ 643: {region: 0x165, script: 0x57, flags: 0x0},
+ 644: {region: 0x165, script: 0x57, flags: 0x0},
+ 645: {region: 0x165, script: 0x29, flags: 0x0},
+ 646: {region: 0x123, script: 0xdf, flags: 0x0},
+ 647: {region: 0xe8, script: 0x5, flags: 0x0},
+ 648: {region: 0x165, script: 0x57, flags: 0x0},
+ 649: {region: 0x165, script: 0x57, flags: 0x0},
+ 650: {region: 0x1c, script: 0x5, flags: 0x1},
+ 651: {region: 0x165, script: 0x57, flags: 0x0},
+ 652: {region: 0x165, script: 0x57, flags: 0x0},
+ 653: {region: 0x165, script: 0x57, flags: 0x0},
+ 654: {region: 0x138, script: 0x57, flags: 0x0},
+ 655: {region: 0x87, script: 0x5b, flags: 0x0},
+ 656: {region: 0x97, script: 0x3b, flags: 0x0},
+ 657: {region: 0x12f, script: 0x57, flags: 0x0},
+ 658: {region: 0xe8, script: 0x5, flags: 0x0},
+ 659: {region: 0x131, script: 0x57, flags: 0x0},
+ 660: {region: 0x165, script: 0x57, flags: 0x0},
+ 661: {region: 0xb7, script: 0x57, flags: 0x0},
+ 662: {region: 0x106, script: 0x1f, flags: 0x0},
+ 663: {region: 0x165, script: 0x57, flags: 0x0},
+ 664: {region: 0x95, script: 0x57, flags: 0x0},
+ 665: {region: 0x165, script: 0x57, flags: 0x0},
+ 666: {region: 0x53, script: 0xdf, flags: 0x0},
+ 667: {region: 0x165, script: 0x57, flags: 0x0},
+ 668: {region: 0x165, script: 0x57, flags: 0x0},
+ 669: {region: 0x165, script: 0x57, flags: 0x0},
+ 670: {region: 0x165, script: 0x57, flags: 0x0},
+ 671: {region: 0x99, script: 0x59, flags: 0x0},
+ 672: {region: 0x165, script: 0x57, flags: 0x0},
+ 673: {region: 0x165, script: 0x57, flags: 0x0},
+ 674: {region: 0x106, script: 0x1f, flags: 0x0},
+ 675: {region: 0x131, script: 0x57, flags: 0x0},
+ 676: {region: 0x165, script: 0x57, flags: 0x0},
+ 677: {region: 0xd9, script: 0x57, flags: 0x0},
+ 678: {region: 0x165, script: 0x57, flags: 0x0},
+ 679: {region: 0x165, script: 0x57, flags: 0x0},
+ 680: {region: 0x21, script: 0x2, flags: 0x1},
+ 681: {region: 0x165, script: 0x57, flags: 0x0},
+ 682: {region: 0x165, script: 0x57, flags: 0x0},
+ 683: {region: 0x9e, script: 0x57, flags: 0x0},
+ 684: {region: 0x53, script: 0x5d, flags: 0x0},
+ 685: {region: 0x95, script: 0x57, flags: 0x0},
+ 686: {region: 0x9c, script: 0x5, flags: 0x0},
+ 687: {region: 0x135, script: 0x57, flags: 0x0},
+ 688: {region: 0x165, script: 0x57, flags: 0x0},
+ 689: {region: 0x165, script: 0x57, flags: 0x0},
+ 690: {region: 0x99, script: 0xda, flags: 0x0},
+ 691: {region: 0x9e, script: 0x57, flags: 0x0},
+ 692: {region: 0x165, script: 0x57, flags: 0x0},
+ 693: {region: 0x4b, script: 0x57, flags: 0x0},
+ 694: {region: 0x165, script: 0x57, flags: 0x0},
+ 695: {region: 0x165, script: 0x57, flags: 0x0},
+ 696: {region: 0xaf, script: 0x54, flags: 0x0},
+ 697: {region: 0x165, script: 0x57, flags: 0x0},
+ 698: {region: 0x165, script: 0x57, flags: 0x0},
+ 699: {region: 0x4b, script: 0x57, flags: 0x0},
+ 700: {region: 0x165, script: 0x57, flags: 0x0},
+ 701: {region: 0x165, script: 0x57, flags: 0x0},
+ 702: {region: 0x162, script: 0x57, flags: 0x0},
+ 703: {region: 0x9c, script: 0x5, flags: 0x0},
+ 704: {region: 0xb6, script: 0x57, flags: 0x0},
+ 705: {region: 0xb8, script: 0x57, flags: 0x0},
+ 706: {region: 0x4b, script: 0x57, flags: 0x0},
+ 707: {region: 0x4b, script: 0x57, flags: 0x0},
+ 708: {region: 0xa4, script: 0x57, flags: 0x0},
+ 709: {region: 0xa4, script: 0x57, flags: 0x0},
+ 710: {region: 0x9c, script: 0x5, flags: 0x0},
+ 711: {region: 0xb8, script: 0x57, flags: 0x0},
+ 712: {region: 0x123, script: 0xdf, flags: 0x0},
+ 713: {region: 0x53, script: 0x38, flags: 0x0},
+ 714: {region: 0x12b, script: 0x57, flags: 0x0},
+ 715: {region: 0x95, script: 0x57, flags: 0x0},
+ 716: {region: 0x52, script: 0x57, flags: 0x0},
+ 717: {region: 0x99, script: 0x21, flags: 0x0},
+ 718: {region: 0x99, script: 0x21, flags: 0x0},
+ 719: {region: 0x95, script: 0x57, flags: 0x0},
+ 720: {region: 0x23, script: 0x3, flags: 0x1},
+ 721: {region: 0xa4, script: 0x57, flags: 0x0},
+ 722: {region: 0x165, script: 0x57, flags: 0x0},
+ 723: {region: 0xcf, script: 0x57, flags: 0x0},
+ 724: {region: 0x165, script: 0x57, flags: 0x0},
+ 725: {region: 0x165, script: 0x57, flags: 0x0},
+ 726: {region: 0x165, script: 0x57, flags: 0x0},
+ 727: {region: 0x165, script: 0x57, flags: 0x0},
+ 728: {region: 0x165, script: 0x57, flags: 0x0},
+ 729: {region: 0x165, script: 0x57, flags: 0x0},
+ 730: {region: 0x165, script: 0x57, flags: 0x0},
+ 731: {region: 0x165, script: 0x57, flags: 0x0},
+ 732: {region: 0x165, script: 0x57, flags: 0x0},
+ 733: {region: 0x165, script: 0x57, flags: 0x0},
+ 734: {region: 0x165, script: 0x57, flags: 0x0},
+ 735: {region: 0x165, script: 0x5, flags: 0x0},
+ 736: {region: 0x106, script: 0x1f, flags: 0x0},
+ 737: {region: 0xe7, script: 0x57, flags: 0x0},
+ 738: {region: 0x165, script: 0x57, flags: 0x0},
+ 739: {region: 0x95, script: 0x57, flags: 0x0},
+ 740: {region: 0x165, script: 0x29, flags: 0x0},
+ 741: {region: 0x165, script: 0x57, flags: 0x0},
+ 742: {region: 0x165, script: 0x57, flags: 0x0},
+ 743: {region: 0x165, script: 0x57, flags: 0x0},
+ 744: {region: 0x112, script: 0x57, flags: 0x0},
+ 745: {region: 0xa4, script: 0x57, flags: 0x0},
+ 746: {region: 0x165, script: 0x57, flags: 0x0},
+ 747: {region: 0x165, script: 0x57, flags: 0x0},
+ 748: {region: 0x123, script: 0x5, flags: 0x0},
+ 749: {region: 0xcc, script: 0x57, flags: 0x0},
+ 750: {region: 0x165, script: 0x57, flags: 0x0},
+ 751: {region: 0x165, script: 0x57, flags: 0x0},
+ 752: {region: 0x165, script: 0x57, flags: 0x0},
+ 753: {region: 0xbf, script: 0x57, flags: 0x0},
+ 754: {region: 0xd1, script: 0x57, flags: 0x0},
+ 755: {region: 0x165, script: 0x57, flags: 0x0},
+ 756: {region: 0x52, script: 0x57, flags: 0x0},
+ 757: {region: 0xdb, script: 0x21, flags: 0x0},
+ 758: {region: 0x12f, script: 0x57, flags: 0x0},
+ 759: {region: 0xc0, script: 0x57, flags: 0x0},
+ 760: {region: 0x165, script: 0x57, flags: 0x0},
+ 761: {region: 0x165, script: 0x57, flags: 0x0},
+ 762: {region: 0xe0, script: 0x57, flags: 0x0},
+ 763: {region: 0x165, script: 0x57, flags: 0x0},
+ 764: {region: 0x95, script: 0x57, flags: 0x0},
+ 765: {region: 0x9b, script: 0x3a, flags: 0x0},
+ 766: {region: 0x165, script: 0x57, flags: 0x0},
+ 767: {region: 0xc2, script: 0x1f, flags: 0x0},
+ 768: {region: 0x165, script: 0x5, flags: 0x0},
+ 769: {region: 0x165, script: 0x57, flags: 0x0},
+ 770: {region: 0x165, script: 0x57, flags: 0x0},
+ 771: {region: 0x165, script: 0x57, flags: 0x0},
+ 772: {region: 0x99, script: 0x6b, flags: 0x0},
+ 773: {region: 0x165, script: 0x57, flags: 0x0},
+ 774: {region: 0x165, script: 0x57, flags: 0x0},
+ 775: {region: 0x10b, script: 0x57, flags: 0x0},
+ 776: {region: 0x165, script: 0x57, flags: 0x0},
+ 777: {region: 0x165, script: 0x57, flags: 0x0},
+ 778: {region: 0x165, script: 0x57, flags: 0x0},
+ 779: {region: 0x26, script: 0x3, flags: 0x1},
+ 780: {region: 0x165, script: 0x57, flags: 0x0},
+ 781: {region: 0x165, script: 0x57, flags: 0x0},
+ 782: {region: 0x99, script: 0xe, flags: 0x0},
+ 783: {region: 0xc4, script: 0x72, flags: 0x0},
+ 785: {region: 0x165, script: 0x57, flags: 0x0},
+ 786: {region: 0x49, script: 0x57, flags: 0x0},
+ 787: {region: 0x49, script: 0x57, flags: 0x0},
+ 788: {region: 0x37, script: 0x57, flags: 0x0},
+ 789: {region: 0x165, script: 0x57, flags: 0x0},
+ 790: {region: 0x165, script: 0x57, flags: 0x0},
+ 791: {region: 0x165, script: 0x57, flags: 0x0},
+ 792: {region: 0x165, script: 0x57, flags: 0x0},
+ 793: {region: 0x165, script: 0x57, flags: 0x0},
+ 794: {region: 0x165, script: 0x57, flags: 0x0},
+ 795: {region: 0x99, script: 0x21, flags: 0x0},
+ 796: {region: 0xdb, script: 0x21, flags: 0x0},
+ 797: {region: 0x106, script: 0x1f, flags: 0x0},
+ 798: {region: 0x35, script: 0x6f, flags: 0x0},
+ 799: {region: 0x29, script: 0x3, flags: 0x1},
+ 800: {region: 0xcb, script: 0x57, flags: 0x0},
+ 801: {region: 0x165, script: 0x57, flags: 0x0},
+ 802: {region: 0x165, script: 0x57, flags: 0x0},
+ 803: {region: 0x165, script: 0x57, flags: 0x0},
+ 804: {region: 0x99, script: 0x21, flags: 0x0},
+ 805: {region: 0x52, script: 0x57, flags: 0x0},
+ 807: {region: 0x165, script: 0x57, flags: 0x0},
+ 808: {region: 0x135, script: 0x57, flags: 0x0},
+ 809: {region: 0x165, script: 0x57, flags: 0x0},
+ 810: {region: 0x165, script: 0x57, flags: 0x0},
+ 811: {region: 0xe8, script: 0x5, flags: 0x0},
+ 812: {region: 0xc3, script: 0x57, flags: 0x0},
+ 813: {region: 0x99, script: 0x21, flags: 0x0},
+ 814: {region: 0x95, script: 0x57, flags: 0x0},
+ 815: {region: 0x164, script: 0x57, flags: 0x0},
+ 816: {region: 0x165, script: 0x57, flags: 0x0},
+ 817: {region: 0xc4, script: 0x72, flags: 0x0},
+ 818: {region: 0x165, script: 0x57, flags: 0x0},
+ 819: {region: 0x165, script: 0x29, flags: 0x0},
+ 820: {region: 0x106, script: 0x1f, flags: 0x0},
+ 821: {region: 0x165, script: 0x57, flags: 0x0},
+ 822: {region: 0x131, script: 0x57, flags: 0x0},
+ 823: {region: 0x9c, script: 0x63, flags: 0x0},
+ 824: {region: 0x165, script: 0x57, flags: 0x0},
+ 825: {region: 0x165, script: 0x57, flags: 0x0},
+ 826: {region: 0x9c, script: 0x5, flags: 0x0},
+ 827: {region: 0x165, script: 0x57, flags: 0x0},
+ 828: {region: 0x165, script: 0x57, flags: 0x0},
+ 829: {region: 0x165, script: 0x57, flags: 0x0},
+ 830: {region: 0xdd, script: 0x57, flags: 0x0},
+ 831: {region: 0x165, script: 0x57, flags: 0x0},
+ 832: {region: 0x165, script: 0x57, flags: 0x0},
+ 834: {region: 0x165, script: 0x57, flags: 0x0},
+ 835: {region: 0x53, script: 0x38, flags: 0x0},
+ 836: {region: 0x9e, script: 0x57, flags: 0x0},
+ 837: {region: 0xd2, script: 0x57, flags: 0x0},
+ 838: {region: 0x165, script: 0x57, flags: 0x0},
+ 839: {region: 0xda, script: 0x57, flags: 0x0},
+ 840: {region: 0x165, script: 0x57, flags: 0x0},
+ 841: {region: 0x165, script: 0x57, flags: 0x0},
+ 842: {region: 0x165, script: 0x57, flags: 0x0},
+ 843: {region: 0xcf, script: 0x57, flags: 0x0},
+ 844: {region: 0x165, script: 0x57, flags: 0x0},
+ 845: {region: 0x165, script: 0x57, flags: 0x0},
+ 846: {region: 0x164, script: 0x57, flags: 0x0},
+ 847: {region: 0xd1, script: 0x57, flags: 0x0},
+ 848: {region: 0x60, script: 0x57, flags: 0x0},
+ 849: {region: 0xdb, script: 0x21, flags: 0x0},
+ 850: {region: 0x165, script: 0x57, flags: 0x0},
+ 851: {region: 0xdb, script: 0x21, flags: 0x0},
+ 852: {region: 0x165, script: 0x57, flags: 0x0},
+ 853: {region: 0x165, script: 0x57, flags: 0x0},
+ 854: {region: 0xd2, script: 0x57, flags: 0x0},
+ 855: {region: 0x165, script: 0x57, flags: 0x0},
+ 856: {region: 0x165, script: 0x57, flags: 0x0},
+ 857: {region: 0xd1, script: 0x57, flags: 0x0},
+ 858: {region: 0x165, script: 0x57, flags: 0x0},
+ 859: {region: 0xcf, script: 0x57, flags: 0x0},
+ 860: {region: 0xcf, script: 0x57, flags: 0x0},
+ 861: {region: 0x165, script: 0x57, flags: 0x0},
+ 862: {region: 0x165, script: 0x57, flags: 0x0},
+ 863: {region: 0x95, script: 0x57, flags: 0x0},
+ 864: {region: 0x165, script: 0x57, flags: 0x0},
+ 865: {region: 0xdf, script: 0x57, flags: 0x0},
+ 866: {region: 0x165, script: 0x57, flags: 0x0},
+ 867: {region: 0x165, script: 0x57, flags: 0x0},
+ 868: {region: 0x99, script: 0x57, flags: 0x0},
+ 869: {region: 0x165, script: 0x57, flags: 0x0},
+ 870: {region: 0x165, script: 0x57, flags: 0x0},
+ 871: {region: 0xd9, script: 0x57, flags: 0x0},
+ 872: {region: 0x52, script: 0x57, flags: 0x0},
+ 873: {region: 0x165, script: 0x57, flags: 0x0},
+ 874: {region: 0xda, script: 0x57, flags: 0x0},
+ 875: {region: 0x165, script: 0x57, flags: 0x0},
+ 876: {region: 0x52, script: 0x57, flags: 0x0},
+ 877: {region: 0x165, script: 0x57, flags: 0x0},
+ 878: {region: 0x165, script: 0x57, flags: 0x0},
+ 879: {region: 0xda, script: 0x57, flags: 0x0},
+ 880: {region: 0x123, script: 0x53, flags: 0x0},
+ 881: {region: 0x99, script: 0x21, flags: 0x0},
+ 882: {region: 0x10c, script: 0xbf, flags: 0x0},
+ 883: {region: 0x165, script: 0x57, flags: 0x0},
+ 884: {region: 0x165, script: 0x57, flags: 0x0},
+ 885: {region: 0x84, script: 0x78, flags: 0x0},
+ 886: {region: 0x161, script: 0x57, flags: 0x0},
+ 887: {region: 0x165, script: 0x57, flags: 0x0},
+ 888: {region: 0x49, script: 0x17, flags: 0x0},
+ 889: {region: 0x165, script: 0x57, flags: 0x0},
+ 890: {region: 0x161, script: 0x57, flags: 0x0},
+ 891: {region: 0x165, script: 0x57, flags: 0x0},
+ 892: {region: 0x165, script: 0x57, flags: 0x0},
+ 893: {region: 0x165, script: 0x57, flags: 0x0},
+ 894: {region: 0x165, script: 0x57, flags: 0x0},
+ 895: {region: 0x165, script: 0x57, flags: 0x0},
+ 896: {region: 0x117, script: 0x57, flags: 0x0},
+ 897: {region: 0x165, script: 0x57, flags: 0x0},
+ 898: {region: 0x165, script: 0x57, flags: 0x0},
+ 899: {region: 0x135, script: 0x57, flags: 0x0},
+ 900: {region: 0x165, script: 0x57, flags: 0x0},
+ 901: {region: 0x53, script: 0x57, flags: 0x0},
+ 902: {region: 0x165, script: 0x57, flags: 0x0},
+ 903: {region: 0xce, script: 0x57, flags: 0x0},
+ 904: {region: 0x12f, script: 0x57, flags: 0x0},
+ 905: {region: 0x131, script: 0x57, flags: 0x0},
+ 906: {region: 0x80, script: 0x57, flags: 0x0},
+ 907: {region: 0x78, script: 0x57, flags: 0x0},
+ 908: {region: 0x165, script: 0x57, flags: 0x0},
+ 910: {region: 0x165, script: 0x57, flags: 0x0},
+ 911: {region: 0x165, script: 0x57, flags: 0x0},
+ 912: {region: 0x6f, script: 0x57, flags: 0x0},
+ 913: {region: 0x165, script: 0x57, flags: 0x0},
+ 914: {region: 0x165, script: 0x57, flags: 0x0},
+ 915: {region: 0x165, script: 0x57, flags: 0x0},
+ 916: {region: 0x165, script: 0x57, flags: 0x0},
+ 917: {region: 0x99, script: 0x7d, flags: 0x0},
+ 918: {region: 0x165, script: 0x57, flags: 0x0},
+ 919: {region: 0x165, script: 0x5, flags: 0x0},
+ 920: {region: 0x7d, script: 0x1f, flags: 0x0},
+ 921: {region: 0x135, script: 0x7e, flags: 0x0},
+ 922: {region: 0x165, script: 0x5, flags: 0x0},
+ 923: {region: 0xc5, script: 0x7c, flags: 0x0},
+ 924: {region: 0x165, script: 0x57, flags: 0x0},
+ 925: {region: 0x2c, script: 0x3, flags: 0x1},
+ 926: {region: 0xe7, script: 0x57, flags: 0x0},
+ 927: {region: 0x2f, script: 0x2, flags: 0x1},
+ 928: {region: 0xe7, script: 0x57, flags: 0x0},
+ 929: {region: 0x30, script: 0x57, flags: 0x0},
+ 930: {region: 0xf0, script: 0x57, flags: 0x0},
+ 931: {region: 0x165, script: 0x57, flags: 0x0},
+ 932: {region: 0x78, script: 0x57, flags: 0x0},
+ 933: {region: 0xd6, script: 0x57, flags: 0x0},
+ 934: {region: 0x135, script: 0x57, flags: 0x0},
+ 935: {region: 0x49, script: 0x57, flags: 0x0},
+ 936: {region: 0x165, script: 0x57, flags: 0x0},
+ 937: {region: 0x9c, script: 0xe8, flags: 0x0},
+ 938: {region: 0x165, script: 0x57, flags: 0x0},
+ 939: {region: 0x60, script: 0x57, flags: 0x0},
+ 940: {region: 0x165, script: 0x5, flags: 0x0},
+ 941: {region: 0xb0, script: 0x87, flags: 0x0},
+ 943: {region: 0x165, script: 0x57, flags: 0x0},
+ 944: {region: 0x165, script: 0x57, flags: 0x0},
+ 945: {region: 0x99, script: 0x12, flags: 0x0},
+ 946: {region: 0xa4, script: 0x57, flags: 0x0},
+ 947: {region: 0xe9, script: 0x57, flags: 0x0},
+ 948: {region: 0x165, script: 0x57, flags: 0x0},
+ 949: {region: 0x9e, script: 0x57, flags: 0x0},
+ 950: {region: 0x165, script: 0x57, flags: 0x0},
+ 951: {region: 0x165, script: 0x57, flags: 0x0},
+ 952: {region: 0x87, script: 0x31, flags: 0x0},
+ 953: {region: 0x75, script: 0x57, flags: 0x0},
+ 954: {region: 0x165, script: 0x57, flags: 0x0},
+ 955: {region: 0xe8, script: 0x4a, flags: 0x0},
+ 956: {region: 0x9c, script: 0x5, flags: 0x0},
+ 957: {region: 0x1, script: 0x57, flags: 0x0},
+ 958: {region: 0x24, script: 0x5, flags: 0x0},
+ 959: {region: 0x165, script: 0x57, flags: 0x0},
+ 960: {region: 0x41, script: 0x57, flags: 0x0},
+ 961: {region: 0x165, script: 0x57, flags: 0x0},
+ 962: {region: 0x7a, script: 0x57, flags: 0x0},
+ 963: {region: 0x165, script: 0x57, flags: 0x0},
+ 964: {region: 0xe4, script: 0x57, flags: 0x0},
+ 965: {region: 0x89, script: 0x57, flags: 0x0},
+ 966: {region: 0x69, script: 0x57, flags: 0x0},
+ 967: {region: 0x165, script: 0x57, flags: 0x0},
+ 968: {region: 0x99, script: 0x21, flags: 0x0},
+ 969: {region: 0x165, script: 0x57, flags: 0x0},
+ 970: {region: 0x102, script: 0x57, flags: 0x0},
+ 971: {region: 0x95, script: 0x57, flags: 0x0},
+ 972: {region: 0x165, script: 0x57, flags: 0x0},
+ 973: {region: 0x165, script: 0x57, flags: 0x0},
+ 974: {region: 0x9e, script: 0x57, flags: 0x0},
+ 975: {region: 0x165, script: 0x5, flags: 0x0},
+ 976: {region: 0x99, script: 0x57, flags: 0x0},
+ 977: {region: 0x31, script: 0x2, flags: 0x1},
+ 978: {region: 0xdb, script: 0x21, flags: 0x0},
+ 979: {region: 0x35, script: 0xe, flags: 0x0},
+ 980: {region: 0x4e, script: 0x57, flags: 0x0},
+ 981: {region: 0x72, script: 0x57, flags: 0x0},
+ 982: {region: 0x4e, script: 0x57, flags: 0x0},
+ 983: {region: 0x9c, script: 0x5, flags: 0x0},
+ 984: {region: 0x10c, script: 0x57, flags: 0x0},
+ 985: {region: 0x3a, script: 0x57, flags: 0x0},
+ 986: {region: 0x165, script: 0x57, flags: 0x0},
+ 987: {region: 0xd1, script: 0x57, flags: 0x0},
+ 988: {region: 0x104, script: 0x57, flags: 0x0},
+ 989: {region: 0x95, script: 0x57, flags: 0x0},
+ 990: {region: 0x12f, script: 0x57, flags: 0x0},
+ 991: {region: 0x165, script: 0x57, flags: 0x0},
+ 992: {region: 0x165, script: 0x57, flags: 0x0},
+ 993: {region: 0x73, script: 0x57, flags: 0x0},
+ 994: {region: 0x106, script: 0x1f, flags: 0x0},
+ 995: {region: 0x130, script: 0x1f, flags: 0x0},
+ 996: {region: 0x109, script: 0x57, flags: 0x0},
+ 997: {region: 0x107, script: 0x57, flags: 0x0},
+ 998: {region: 0x12f, script: 0x57, flags: 0x0},
+ 999: {region: 0x165, script: 0x57, flags: 0x0},
+ 1000: {region: 0xa2, script: 0x49, flags: 0x0},
+ 1001: {region: 0x99, script: 0x21, flags: 0x0},
+ 1002: {region: 0x80, script: 0x57, flags: 0x0},
+ 1003: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1004: {region: 0xa4, script: 0x57, flags: 0x0},
+ 1005: {region: 0x95, script: 0x57, flags: 0x0},
+ 1006: {region: 0x99, script: 0x57, flags: 0x0},
+ 1007: {region: 0x114, script: 0x57, flags: 0x0},
+ 1008: {region: 0x99, script: 0xc3, flags: 0x0},
+ 1009: {region: 0x165, script: 0x57, flags: 0x0},
+ 1010: {region: 0x165, script: 0x57, flags: 0x0},
+ 1011: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1012: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1013: {region: 0x99, script: 0x21, flags: 0x0},
+ 1014: {region: 0x165, script: 0x5, flags: 0x0},
+ 1015: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1016: {region: 0x7b, script: 0x57, flags: 0x0},
+ 1017: {region: 0x49, script: 0x57, flags: 0x0},
+ 1018: {region: 0x33, script: 0x4, flags: 0x1},
+ 1019: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1020: {region: 0x9c, script: 0x5, flags: 0x0},
+ 1021: {region: 0xda, script: 0x57, flags: 0x0},
+ 1022: {region: 0x4f, script: 0x57, flags: 0x0},
+ 1023: {region: 0xd1, script: 0x57, flags: 0x0},
+ 1024: {region: 0xcf, script: 0x57, flags: 0x0},
+ 1025: {region: 0xc3, script: 0x57, flags: 0x0},
+ 1026: {region: 0x4c, script: 0x57, flags: 0x0},
+ 1027: {region: 0x96, script: 0x7a, flags: 0x0},
+ 1028: {region: 0xb6, script: 0x57, flags: 0x0},
+ 1029: {region: 0x165, script: 0x29, flags: 0x0},
+ 1030: {region: 0x165, script: 0x57, flags: 0x0},
+ 1032: {region: 0xba, script: 0xdc, flags: 0x0},
+ 1033: {region: 0x165, script: 0x57, flags: 0x0},
+ 1034: {region: 0xc4, script: 0x72, flags: 0x0},
+ 1035: {region: 0x165, script: 0x5, flags: 0x0},
+ 1036: {region: 0xb3, script: 0xca, flags: 0x0},
+ 1037: {region: 0x6f, script: 0x57, flags: 0x0},
+ 1038: {region: 0x165, script: 0x57, flags: 0x0},
+ 1039: {region: 0x165, script: 0x57, flags: 0x0},
+ 1040: {region: 0x165, script: 0x57, flags: 0x0},
+ 1041: {region: 0x165, script: 0x57, flags: 0x0},
+ 1042: {region: 0x111, script: 0x57, flags: 0x0},
+ 1043: {region: 0x165, script: 0x57, flags: 0x0},
+ 1044: {region: 0xe8, script: 0x5, flags: 0x0},
+ 1045: {region: 0x165, script: 0x57, flags: 0x0},
+ 1046: {region: 0x10f, script: 0x57, flags: 0x0},
+ 1047: {region: 0x165, script: 0x57, flags: 0x0},
+ 1048: {region: 0xe9, script: 0x57, flags: 0x0},
+ 1049: {region: 0x165, script: 0x57, flags: 0x0},
+ 1050: {region: 0x95, script: 0x57, flags: 0x0},
+ 1051: {region: 0x142, script: 0x57, flags: 0x0},
+ 1052: {region: 0x10c, script: 0x57, flags: 0x0},
+ 1054: {region: 0x10c, script: 0x57, flags: 0x0},
+ 1055: {region: 0x72, script: 0x57, flags: 0x0},
+ 1056: {region: 0x97, script: 0xc0, flags: 0x0},
+ 1057: {region: 0x165, script: 0x57, flags: 0x0},
+ 1058: {region: 0x72, script: 0x57, flags: 0x0},
+ 1059: {region: 0x164, script: 0x57, flags: 0x0},
+ 1060: {region: 0x165, script: 0x57, flags: 0x0},
+ 1061: {region: 0xc3, script: 0x57, flags: 0x0},
+ 1062: {region: 0x165, script: 0x57, flags: 0x0},
+ 1063: {region: 0x165, script: 0x57, flags: 0x0},
+ 1064: {region: 0x165, script: 0x57, flags: 0x0},
+ 1065: {region: 0x115, script: 0x57, flags: 0x0},
+ 1066: {region: 0x165, script: 0x57, flags: 0x0},
+ 1067: {region: 0x165, script: 0x57, flags: 0x0},
+ 1068: {region: 0x123, script: 0xdf, flags: 0x0},
+ 1069: {region: 0x165, script: 0x57, flags: 0x0},
+ 1070: {region: 0x165, script: 0x57, flags: 0x0},
+ 1071: {region: 0x165, script: 0x57, flags: 0x0},
+ 1072: {region: 0x165, script: 0x57, flags: 0x0},
+ 1073: {region: 0x27, script: 0x57, flags: 0x0},
+ 1074: {region: 0x37, script: 0x5, flags: 0x1},
+ 1075: {region: 0x99, script: 0xcb, flags: 0x0},
+ 1076: {region: 0x116, script: 0x57, flags: 0x0},
+ 1077: {region: 0x114, script: 0x57, flags: 0x0},
+ 1078: {region: 0x99, script: 0x21, flags: 0x0},
+ 1079: {region: 0x161, script: 0x57, flags: 0x0},
+ 1080: {region: 0x165, script: 0x57, flags: 0x0},
+ 1081: {region: 0x165, script: 0x57, flags: 0x0},
+ 1082: {region: 0x6d, script: 0x57, flags: 0x0},
+ 1083: {region: 0x161, script: 0x57, flags: 0x0},
+ 1084: {region: 0x165, script: 0x57, flags: 0x0},
+ 1085: {region: 0x60, script: 0x57, flags: 0x0},
+ 1086: {region: 0x95, script: 0x57, flags: 0x0},
+ 1087: {region: 0x165, script: 0x57, flags: 0x0},
+ 1088: {region: 0x165, script: 0x57, flags: 0x0},
+ 1089: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1090: {region: 0x165, script: 0x57, flags: 0x0},
+ 1091: {region: 0x84, script: 0x57, flags: 0x0},
+ 1092: {region: 0x10c, script: 0x57, flags: 0x0},
+ 1093: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1094: {region: 0x15f, script: 0x5, flags: 0x0},
+ 1095: {region: 0x4b, script: 0x57, flags: 0x0},
+ 1096: {region: 0x60, script: 0x57, flags: 0x0},
+ 1097: {region: 0x165, script: 0x57, flags: 0x0},
+ 1098: {region: 0x99, script: 0x21, flags: 0x0},
+ 1099: {region: 0x95, script: 0x57, flags: 0x0},
+ 1100: {region: 0x165, script: 0x57, flags: 0x0},
+ 1101: {region: 0x35, script: 0xe, flags: 0x0},
+ 1102: {region: 0x9b, script: 0xcf, flags: 0x0},
+ 1103: {region: 0xe9, script: 0x57, flags: 0x0},
+ 1104: {region: 0x99, script: 0xd7, flags: 0x0},
+ 1105: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1106: {region: 0x165, script: 0x57, flags: 0x0},
+ 1107: {region: 0x165, script: 0x57, flags: 0x0},
+ 1108: {region: 0x165, script: 0x57, flags: 0x0},
+ 1109: {region: 0x165, script: 0x57, flags: 0x0},
+ 1110: {region: 0x165, script: 0x57, flags: 0x0},
+ 1111: {region: 0x165, script: 0x57, flags: 0x0},
+ 1112: {region: 0x165, script: 0x57, flags: 0x0},
+ 1113: {region: 0x165, script: 0x57, flags: 0x0},
+ 1114: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1115: {region: 0x165, script: 0x57, flags: 0x0},
+ 1116: {region: 0x165, script: 0x57, flags: 0x0},
+ 1117: {region: 0x99, script: 0x4f, flags: 0x0},
+ 1118: {region: 0x53, script: 0xd5, flags: 0x0},
+ 1119: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1120: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1121: {region: 0x99, script: 0xda, flags: 0x0},
+ 1122: {region: 0x165, script: 0x57, flags: 0x0},
+ 1123: {region: 0x112, script: 0x57, flags: 0x0},
+ 1124: {region: 0x131, script: 0x57, flags: 0x0},
+ 1125: {region: 0x126, script: 0x57, flags: 0x0},
+ 1126: {region: 0x165, script: 0x57, flags: 0x0},
+ 1127: {region: 0x3c, script: 0x3, flags: 0x1},
+ 1128: {region: 0x165, script: 0x57, flags: 0x0},
+ 1129: {region: 0x165, script: 0x57, flags: 0x0},
+ 1130: {region: 0x165, script: 0x57, flags: 0x0},
+ 1131: {region: 0x123, script: 0xdf, flags: 0x0},
+ 1132: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1133: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1134: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1135: {region: 0x6f, script: 0x29, flags: 0x0},
+ 1136: {region: 0x165, script: 0x57, flags: 0x0},
+ 1137: {region: 0x6d, script: 0x29, flags: 0x0},
+ 1138: {region: 0x165, script: 0x57, flags: 0x0},
+ 1139: {region: 0x165, script: 0x57, flags: 0x0},
+ 1140: {region: 0x165, script: 0x57, flags: 0x0},
+ 1141: {region: 0xd6, script: 0x57, flags: 0x0},
+ 1142: {region: 0x127, script: 0x57, flags: 0x0},
+ 1143: {region: 0x125, script: 0x57, flags: 0x0},
+ 1144: {region: 0x32, script: 0x57, flags: 0x0},
+ 1145: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1146: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1147: {region: 0x165, script: 0x57, flags: 0x0},
+ 1148: {region: 0x165, script: 0x57, flags: 0x0},
+ 1149: {region: 0x32, script: 0x57, flags: 0x0},
+ 1150: {region: 0xd4, script: 0x57, flags: 0x0},
+ 1151: {region: 0x165, script: 0x57, flags: 0x0},
+ 1152: {region: 0x161, script: 0x57, flags: 0x0},
+ 1153: {region: 0x165, script: 0x57, flags: 0x0},
+ 1154: {region: 0x129, script: 0x57, flags: 0x0},
+ 1155: {region: 0x165, script: 0x57, flags: 0x0},
+ 1156: {region: 0xce, script: 0x57, flags: 0x0},
+ 1157: {region: 0x165, script: 0x57, flags: 0x0},
+ 1158: {region: 0xe6, script: 0x57, flags: 0x0},
+ 1159: {region: 0x165, script: 0x57, flags: 0x0},
+ 1160: {region: 0x165, script: 0x57, flags: 0x0},
+ 1161: {region: 0x165, script: 0x57, flags: 0x0},
+ 1162: {region: 0x12b, script: 0x57, flags: 0x0},
+ 1163: {region: 0x12b, script: 0x57, flags: 0x0},
+ 1164: {region: 0x12e, script: 0x57, flags: 0x0},
+ 1165: {region: 0x165, script: 0x5, flags: 0x0},
+ 1166: {region: 0x161, script: 0x57, flags: 0x0},
+ 1167: {region: 0x87, script: 0x31, flags: 0x0},
+ 1168: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1169: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1170: {region: 0x43, script: 0xe0, flags: 0x0},
+ 1171: {region: 0x165, script: 0x57, flags: 0x0},
+ 1172: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1173: {region: 0x165, script: 0x57, flags: 0x0},
+ 1174: {region: 0x165, script: 0x57, flags: 0x0},
+ 1175: {region: 0x131, script: 0x57, flags: 0x0},
+ 1176: {region: 0x165, script: 0x57, flags: 0x0},
+ 1177: {region: 0x123, script: 0xdf, flags: 0x0},
+ 1178: {region: 0x32, script: 0x57, flags: 0x0},
+ 1179: {region: 0x165, script: 0x57, flags: 0x0},
+ 1180: {region: 0x165, script: 0x57, flags: 0x0},
+ 1181: {region: 0xce, script: 0x57, flags: 0x0},
+ 1182: {region: 0x165, script: 0x57, flags: 0x0},
+ 1183: {region: 0x165, script: 0x57, flags: 0x0},
+ 1184: {region: 0x12d, script: 0x57, flags: 0x0},
+ 1185: {region: 0x165, script: 0x57, flags: 0x0},
+ 1187: {region: 0x165, script: 0x57, flags: 0x0},
+ 1188: {region: 0xd4, script: 0x57, flags: 0x0},
+ 1189: {region: 0x53, script: 0xd8, flags: 0x0},
+ 1190: {region: 0xe5, script: 0x57, flags: 0x0},
+ 1191: {region: 0x165, script: 0x57, flags: 0x0},
+ 1192: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1193: {region: 0xba, script: 0x57, flags: 0x0},
+ 1194: {region: 0x165, script: 0x57, flags: 0x0},
+ 1195: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1196: {region: 0x3f, script: 0x4, flags: 0x1},
+ 1197: {region: 0x11c, script: 0xe2, flags: 0x0},
+ 1198: {region: 0x130, script: 0x1f, flags: 0x0},
+ 1199: {region: 0x75, script: 0x57, flags: 0x0},
+ 1200: {region: 0x2a, script: 0x57, flags: 0x0},
+ 1202: {region: 0x43, script: 0x3, flags: 0x1},
+ 1203: {region: 0x99, script: 0xe, flags: 0x0},
+ 1204: {region: 0xe8, script: 0x5, flags: 0x0},
+ 1205: {region: 0x165, script: 0x57, flags: 0x0},
+ 1206: {region: 0x165, script: 0x57, flags: 0x0},
+ 1207: {region: 0x165, script: 0x57, flags: 0x0},
+ 1208: {region: 0x165, script: 0x57, flags: 0x0},
+ 1209: {region: 0x165, script: 0x57, flags: 0x0},
+ 1210: {region: 0x165, script: 0x57, flags: 0x0},
+ 1211: {region: 0x165, script: 0x57, flags: 0x0},
+ 1212: {region: 0x46, script: 0x4, flags: 0x1},
+ 1213: {region: 0x165, script: 0x57, flags: 0x0},
+ 1214: {region: 0xb4, script: 0xe3, flags: 0x0},
+ 1215: {region: 0x165, script: 0x57, flags: 0x0},
+ 1216: {region: 0x161, script: 0x57, flags: 0x0},
+ 1217: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1218: {region: 0x106, script: 0x57, flags: 0x0},
+ 1219: {region: 0x13e, script: 0x57, flags: 0x0},
+ 1220: {region: 0x11b, script: 0x57, flags: 0x0},
+ 1221: {region: 0x165, script: 0x57, flags: 0x0},
+ 1222: {region: 0x36, script: 0x57, flags: 0x0},
+ 1223: {region: 0x60, script: 0x57, flags: 0x0},
+ 1224: {region: 0xd1, script: 0x57, flags: 0x0},
+ 1225: {region: 0x1, script: 0x57, flags: 0x0},
+ 1226: {region: 0x106, script: 0x57, flags: 0x0},
+ 1227: {region: 0x6a, script: 0x57, flags: 0x0},
+ 1228: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1229: {region: 0x165, script: 0x57, flags: 0x0},
+ 1230: {region: 0x36, script: 0x57, flags: 0x0},
+ 1231: {region: 0x4e, script: 0x57, flags: 0x0},
+ 1232: {region: 0x165, script: 0x57, flags: 0x0},
+ 1233: {region: 0x6f, script: 0x29, flags: 0x0},
+ 1234: {region: 0x165, script: 0x57, flags: 0x0},
+ 1235: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1236: {region: 0x2f, script: 0x57, flags: 0x0},
+ 1237: {region: 0x99, script: 0xda, flags: 0x0},
+ 1238: {region: 0x99, script: 0x21, flags: 0x0},
+ 1239: {region: 0x165, script: 0x57, flags: 0x0},
+ 1240: {region: 0x165, script: 0x57, flags: 0x0},
+ 1241: {region: 0x165, script: 0x57, flags: 0x0},
+ 1242: {region: 0x165, script: 0x57, flags: 0x0},
+ 1243: {region: 0x165, script: 0x57, flags: 0x0},
+ 1244: {region: 0x165, script: 0x57, flags: 0x0},
+ 1245: {region: 0x165, script: 0x57, flags: 0x0},
+ 1246: {region: 0x165, script: 0x57, flags: 0x0},
+ 1247: {region: 0x165, script: 0x57, flags: 0x0},
+ 1248: {region: 0x140, script: 0x57, flags: 0x0},
+ 1249: {region: 0x165, script: 0x57, flags: 0x0},
+ 1250: {region: 0x165, script: 0x57, flags: 0x0},
+ 1251: {region: 0xa8, script: 0x5, flags: 0x0},
+ 1252: {region: 0x165, script: 0x57, flags: 0x0},
+ 1253: {region: 0x114, script: 0x57, flags: 0x0},
+ 1254: {region: 0x165, script: 0x57, flags: 0x0},
+ 1255: {region: 0x165, script: 0x57, flags: 0x0},
+ 1256: {region: 0x165, script: 0x57, flags: 0x0},
+ 1257: {region: 0x165, script: 0x57, flags: 0x0},
+ 1258: {region: 0x99, script: 0x21, flags: 0x0},
+ 1259: {region: 0x53, script: 0x38, flags: 0x0},
+ 1260: {region: 0x165, script: 0x57, flags: 0x0},
+ 1261: {region: 0x165, script: 0x57, flags: 0x0},
+ 1262: {region: 0x41, script: 0x57, flags: 0x0},
+ 1263: {region: 0x165, script: 0x57, flags: 0x0},
+ 1264: {region: 0x12b, script: 0x18, flags: 0x0},
+ 1265: {region: 0x165, script: 0x57, flags: 0x0},
+ 1266: {region: 0x161, script: 0x57, flags: 0x0},
+ 1267: {region: 0x165, script: 0x57, flags: 0x0},
+ 1268: {region: 0x12b, script: 0x5f, flags: 0x0},
+ 1269: {region: 0x12b, script: 0x60, flags: 0x0},
+ 1270: {region: 0x7d, script: 0x2b, flags: 0x0},
+ 1271: {region: 0x53, script: 0x64, flags: 0x0},
+ 1272: {region: 0x10b, script: 0x69, flags: 0x0},
+ 1273: {region: 0x108, script: 0x73, flags: 0x0},
+ 1274: {region: 0x99, script: 0x21, flags: 0x0},
+ 1275: {region: 0x131, script: 0x57, flags: 0x0},
+ 1276: {region: 0x165, script: 0x57, flags: 0x0},
+ 1277: {region: 0x9c, script: 0x8a, flags: 0x0},
+ 1278: {region: 0x165, script: 0x57, flags: 0x0},
+ 1279: {region: 0x15e, script: 0xc2, flags: 0x0},
+ 1280: {region: 0x165, script: 0x57, flags: 0x0},
+ 1281: {region: 0x165, script: 0x57, flags: 0x0},
+ 1282: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1283: {region: 0x165, script: 0x57, flags: 0x0},
+ 1284: {region: 0x165, script: 0x57, flags: 0x0},
+ 1285: {region: 0xd1, script: 0x57, flags: 0x0},
+ 1286: {region: 0x75, script: 0x57, flags: 0x0},
+ 1287: {region: 0x165, script: 0x57, flags: 0x0},
+ 1288: {region: 0x165, script: 0x57, flags: 0x0},
+ 1289: {region: 0x52, script: 0x57, flags: 0x0},
+ 1290: {region: 0x165, script: 0x57, flags: 0x0},
+ 1291: {region: 0x165, script: 0x57, flags: 0x0},
+ 1292: {region: 0x165, script: 0x57, flags: 0x0},
+ 1293: {region: 0x52, script: 0x57, flags: 0x0},
+ 1294: {region: 0x165, script: 0x57, flags: 0x0},
+ 1295: {region: 0x165, script: 0x57, flags: 0x0},
+ 1296: {region: 0x165, script: 0x57, flags: 0x0},
+ 1297: {region: 0x165, script: 0x57, flags: 0x0},
+ 1298: {region: 0x1, script: 0x3b, flags: 0x0},
+ 1299: {region: 0x165, script: 0x57, flags: 0x0},
+ 1300: {region: 0x165, script: 0x57, flags: 0x0},
+ 1301: {region: 0x165, script: 0x57, flags: 0x0},
+ 1302: {region: 0x165, script: 0x57, flags: 0x0},
+ 1303: {region: 0x165, script: 0x57, flags: 0x0},
+ 1304: {region: 0xd6, script: 0x57, flags: 0x0},
+ 1305: {region: 0x165, script: 0x57, flags: 0x0},
+ 1306: {region: 0x165, script: 0x57, flags: 0x0},
+ 1307: {region: 0x165, script: 0x57, flags: 0x0},
+ 1308: {region: 0x41, script: 0x57, flags: 0x0},
+ 1309: {region: 0x165, script: 0x57, flags: 0x0},
+ 1310: {region: 0xcf, script: 0x57, flags: 0x0},
+ 1311: {region: 0x4a, script: 0x3, flags: 0x1},
+ 1312: {region: 0x165, script: 0x57, flags: 0x0},
+ 1313: {region: 0x165, script: 0x57, flags: 0x0},
+ 1314: {region: 0x165, script: 0x57, flags: 0x0},
+ 1315: {region: 0x53, script: 0x57, flags: 0x0},
+ 1316: {region: 0x10b, script: 0x57, flags: 0x0},
+ 1318: {region: 0xa8, script: 0x5, flags: 0x0},
+ 1319: {region: 0xd9, script: 0x57, flags: 0x0},
+ 1320: {region: 0xba, script: 0xdc, flags: 0x0},
+ 1321: {region: 0x4d, script: 0x14, flags: 0x1},
+ 1322: {region: 0x53, script: 0x79, flags: 0x0},
+ 1323: {region: 0x165, script: 0x57, flags: 0x0},
+ 1324: {region: 0x122, script: 0x57, flags: 0x0},
+ 1325: {region: 0xd0, script: 0x57, flags: 0x0},
+ 1326: {region: 0x165, script: 0x57, flags: 0x0},
+ 1327: {region: 0x161, script: 0x57, flags: 0x0},
+ 1329: {region: 0x12b, script: 0x57, flags: 0x0},
+}
+
+// likelyLangList holds lists info associated with likelyLang.
+// Size: 388 bytes, 97 elements
+var likelyLangList = [97]likelyScriptRegion{
+ 0: {region: 0x9c, script: 0x7, flags: 0x0},
+ 1: {region: 0xa1, script: 0x74, flags: 0x2},
+ 2: {region: 0x11c, script: 0x80, flags: 0x2},
+ 3: {region: 0x32, script: 0x57, flags: 0x0},
+ 4: {region: 0x9b, script: 0x5, flags: 0x4},
+ 5: {region: 0x9c, script: 0x5, flags: 0x4},
+ 6: {region: 0x106, script: 0x1f, flags: 0x4},
+ 7: {region: 0x9c, script: 0x5, flags: 0x2},
+ 8: {region: 0x106, script: 0x1f, flags: 0x0},
+ 9: {region: 0x38, script: 0x2c, flags: 0x2},
+ 10: {region: 0x135, script: 0x57, flags: 0x0},
+ 11: {region: 0x7b, script: 0xc5, flags: 0x2},
+ 12: {region: 0x114, script: 0x57, flags: 0x0},
+ 13: {region: 0x84, script: 0x1, flags: 0x2},
+ 14: {region: 0x5d, script: 0x1e, flags: 0x0},
+ 15: {region: 0x87, script: 0x5c, flags: 0x2},
+ 16: {region: 0xd6, script: 0x57, flags: 0x0},
+ 17: {region: 0x52, script: 0x5, flags: 0x4},
+ 18: {region: 0x10b, script: 0x5, flags: 0x4},
+ 19: {region: 0xae, script: 0x1f, flags: 0x0},
+ 20: {region: 0x24, script: 0x5, flags: 0x4},
+ 21: {region: 0x53, script: 0x5, flags: 0x4},
+ 22: {region: 0x9c, script: 0x5, flags: 0x4},
+ 23: {region: 0xc5, script: 0x5, flags: 0x4},
+ 24: {region: 0x53, script: 0x5, flags: 0x2},
+ 25: {region: 0x12b, script: 0x57, flags: 0x0},
+ 26: {region: 0xb0, script: 0x5, flags: 0x4},
+ 27: {region: 0x9b, script: 0x5, flags: 0x2},
+ 28: {region: 0xa5, script: 0x1f, flags: 0x0},
+ 29: {region: 0x53, script: 0x5, flags: 0x4},
+ 30: {region: 0x12b, script: 0x57, flags: 0x4},
+ 31: {region: 0x53, script: 0x5, flags: 0x2},
+ 32: {region: 0x12b, script: 0x57, flags: 0x2},
+ 33: {region: 0xdb, script: 0x21, flags: 0x0},
+ 34: {region: 0x99, script: 0x5a, flags: 0x2},
+ 35: {region: 0x83, script: 0x57, flags: 0x0},
+ 36: {region: 0x84, script: 0x78, flags: 0x4},
+ 37: {region: 0x84, script: 0x78, flags: 0x2},
+ 38: {region: 0xc5, script: 0x1f, flags: 0x0},
+ 39: {region: 0x53, script: 0x6d, flags: 0x4},
+ 40: {region: 0x53, script: 0x6d, flags: 0x2},
+ 41: {region: 0xd0, script: 0x57, flags: 0x0},
+ 42: {region: 0x4a, script: 0x5, flags: 0x4},
+ 43: {region: 0x95, script: 0x5, flags: 0x4},
+ 44: {region: 0x99, script: 0x33, flags: 0x0},
+ 45: {region: 0xe8, script: 0x5, flags: 0x4},
+ 46: {region: 0xe8, script: 0x5, flags: 0x2},
+ 47: {region: 0x9c, script: 0x84, flags: 0x0},
+ 48: {region: 0x53, script: 0x85, flags: 0x2},
+ 49: {region: 0xba, script: 0xdc, flags: 0x0},
+ 50: {region: 0xd9, script: 0x57, flags: 0x4},
+ 51: {region: 0xe8, script: 0x5, flags: 0x0},
+ 52: {region: 0x99, script: 0x21, flags: 0x2},
+ 53: {region: 0x99, script: 0x4c, flags: 0x2},
+ 54: {region: 0x99, script: 0xc9, flags: 0x2},
+ 55: {region: 0x105, script: 0x1f, flags: 0x0},
+ 56: {region: 0xbd, script: 0x57, flags: 0x4},
+ 57: {region: 0x104, script: 0x57, flags: 0x4},
+ 58: {region: 0x106, script: 0x57, flags: 0x4},
+ 59: {region: 0x12b, script: 0x57, flags: 0x4},
+ 60: {region: 0x124, script: 0x1f, flags: 0x0},
+ 61: {region: 0xe8, script: 0x5, flags: 0x4},
+ 62: {region: 0xe8, script: 0x5, flags: 0x2},
+ 63: {region: 0x53, script: 0x5, flags: 0x0},
+ 64: {region: 0xae, script: 0x1f, flags: 0x4},
+ 65: {region: 0xc5, script: 0x1f, flags: 0x4},
+ 66: {region: 0xae, script: 0x1f, flags: 0x2},
+ 67: {region: 0x99, script: 0xe, flags: 0x0},
+ 68: {region: 0xdb, script: 0x21, flags: 0x4},
+ 69: {region: 0xdb, script: 0x21, flags: 0x2},
+ 70: {region: 0x137, script: 0x57, flags: 0x0},
+ 71: {region: 0x24, script: 0x5, flags: 0x4},
+ 72: {region: 0x53, script: 0x1f, flags: 0x4},
+ 73: {region: 0x24, script: 0x5, flags: 0x2},
+ 74: {region: 0x8d, script: 0x39, flags: 0x0},
+ 75: {region: 0x53, script: 0x38, flags: 0x4},
+ 76: {region: 0x53, script: 0x38, flags: 0x2},
+ 77: {region: 0x53, script: 0x38, flags: 0x0},
+ 78: {region: 0x2f, script: 0x39, flags: 0x4},
+ 79: {region: 0x3e, script: 0x39, flags: 0x4},
+ 80: {region: 0x7b, script: 0x39, flags: 0x4},
+ 81: {region: 0x7e, script: 0x39, flags: 0x4},
+ 82: {region: 0x8d, script: 0x39, flags: 0x4},
+ 83: {region: 0x95, script: 0x39, flags: 0x4},
+ 84: {region: 0xc6, script: 0x39, flags: 0x4},
+ 85: {region: 0xd0, script: 0x39, flags: 0x4},
+ 86: {region: 0xe2, script: 0x39, flags: 0x4},
+ 87: {region: 0xe5, script: 0x39, flags: 0x4},
+ 88: {region: 0xe7, script: 0x39, flags: 0x4},
+ 89: {region: 0x116, script: 0x39, flags: 0x4},
+ 90: {region: 0x123, script: 0x39, flags: 0x4},
+ 91: {region: 0x12e, script: 0x39, flags: 0x4},
+ 92: {region: 0x135, script: 0x39, flags: 0x4},
+ 93: {region: 0x13e, script: 0x39, flags: 0x4},
+ 94: {region: 0x12e, script: 0x11, flags: 0x2},
+ 95: {region: 0x12e, script: 0x34, flags: 0x2},
+ 96: {region: 0x12e, script: 0x39, flags: 0x2},
+}
+
+type likelyLangScript struct {
+ lang uint16
+ script uint8
+ flags uint8
+}
+
+// likelyRegion is a lookup table, indexed by regionID, for the most likely
+// languages and scripts given incomplete information. If more entries exist
+// for a given regionID, lang and script are the index and size respectively
+// of the list in likelyRegionList.
+// TODO: exclude containers and user-definable regions from the list.
+// Size: 1432 bytes, 358 elements
+var likelyRegion = [358]likelyLangScript{
+ 34: {lang: 0xd7, script: 0x57, flags: 0x0},
+ 35: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 36: {lang: 0x0, script: 0x2, flags: 0x1},
+ 39: {lang: 0x2, script: 0x2, flags: 0x1},
+ 40: {lang: 0x4, script: 0x2, flags: 0x1},
+ 42: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 43: {lang: 0x0, script: 0x57, flags: 0x0},
+ 44: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 45: {lang: 0x41b, script: 0x57, flags: 0x0},
+ 46: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 48: {lang: 0x367, script: 0x57, flags: 0x0},
+ 49: {lang: 0x444, script: 0x57, flags: 0x0},
+ 50: {lang: 0x58, script: 0x57, flags: 0x0},
+ 51: {lang: 0x6, script: 0x2, flags: 0x1},
+ 53: {lang: 0xa5, script: 0xe, flags: 0x0},
+ 54: {lang: 0x367, script: 0x57, flags: 0x0},
+ 55: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 56: {lang: 0x7e, script: 0x1f, flags: 0x0},
+ 57: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 58: {lang: 0x3d9, script: 0x57, flags: 0x0},
+ 59: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 60: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 62: {lang: 0x31f, script: 0x57, flags: 0x0},
+ 63: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 64: {lang: 0x3a1, script: 0x57, flags: 0x0},
+ 65: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 67: {lang: 0x8, script: 0x2, flags: 0x1},
+ 69: {lang: 0x0, script: 0x57, flags: 0x0},
+ 71: {lang: 0x71, script: 0x1f, flags: 0x0},
+ 73: {lang: 0x512, script: 0x3b, flags: 0x2},
+ 74: {lang: 0x31f, script: 0x5, flags: 0x2},
+ 75: {lang: 0x445, script: 0x57, flags: 0x0},
+ 76: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 77: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 78: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 79: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 81: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 82: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 83: {lang: 0xa, script: 0x4, flags: 0x1},
+ 84: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 85: {lang: 0x0, script: 0x57, flags: 0x0},
+ 86: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 89: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 90: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 91: {lang: 0x3a1, script: 0x57, flags: 0x0},
+ 93: {lang: 0xe, script: 0x2, flags: 0x1},
+ 94: {lang: 0xfa, script: 0x57, flags: 0x0},
+ 96: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 98: {la